IT-Reviews    

ВЗАИМОДЕЙСТВИЕ АНАЛОГА ПЕПТИДА СЛИЯНИЯ ИЗ ГЕМАГГЛЮТИНИНА ВИРУСА ГРИППА С ФОСФОЛИПИДНЫМИ ЛИПОСОМАМИ: ИЗУЧЕНИЕ МЕТОДОМ 31Р-ЯМР

c78089d0 Источник:
Лесовой Д.М. Жмак М.Н. Люкманова Е.Н. Дубовский П.В. Статья в формате PDF 112 KB

Пептиды слияния - фрагменты вирусных белков, состоящие из 20-25 аминокислот, способные вызывать слияние липидных и биологических мембран [1]. При изучении этих процессов удобно работать с водорастворимыми аналогами. Нами сконструирован аналог F31, состоящий из 31-го аминокислотного остатка: glfgaiagfieggwtgmidgwygygggkkkk.

С-концевой фрагмент GCGKKK обеспечивает водорастворимостиь пептида, а N-концевая часть (остатки 1-24) соответствует пептиду слияния из гемагглютинина (штамм A/PR/8/34). В пептиде имеется только один остаток глутаминовой кислоты (Glu11). Цель данной работы - изучить влияние пептида F31 на фосфолипидные липосомы при различных состояниях ионизации этого остатка. С учётом данных по величинам рКа остатков Glu в пептидах слияния, находящихся в мембранном окружении, есть основания считать, что при изменении рН от 7 до 4 с большой долей вероятности происходит протонирование боковой карбоксильной группы этого остатка. Поэтому нами взяты эти значения рН как такие, при которых остаток полностью заряжен (рН 7) и нейтрален (рН 4), соответственно. Фосфолипидные липосомы формировались из анионного фосфолипида диолеоилфосфатидилглицерина (ДОФГ). Т.к. заряд пептида в целом положителен при обоих значениях рН (4 и 7), это обеспечивает эффективное связывание с пловерхностью липосом за счёт электростатического притяжения. Следовательно, изменение характера вляиния пептида на липосомы при изменении рн от 7 до 4 будет означать изменение характера гидрофобного взаимодействия пептида с липосомами, вероятно, за счёт изменения глубины проникновения пептида в фосфолипидный бислой и/или характера ассоции пептидов на липосомах.

Наиболее удобным методом для исследования взаимодействий липид/пептид является метод 31P-ЯМР спектроскопии широких линий. Данный метод позволяет работать с бислойными мультиламеллярными липосомами, которые более адекватно моделирует биологическую мембрану. Показано, что форма линии 31P-ЯМР спектров мембран чувствительна к анизотропным движениям молекул фосфолипидов[2, 3], что позволяет следить за изменениями состояния модельной мембраны под воздействием пептида.

Для изучения рН-зависимости взаимодействия были проведены серии экспериментов при рН 4 и 7. Проанализировав полученные 31Р-ЯМР спектры с помощью разработанной нами программы P-FIT [4], были получены зависимости параметров, характеризующих состояние бислоя в зависимости от соотношения липид/пептид.

При рН 4 наблюдается значительное влияние пептида на состояние бислоя. Так, при последовательном добавлении пептида, начиная с соотношения липид/пептид 40:1 происходит формирование второй анизотропной составляющей. Данная составляющая характеризуется уменьшенным значением анизотропии химического сдвига а также уменьшенным значением степени деформации липосом магнитным полем спектрометра, что связано с уменьшением эластичности мембраны. При уменьшением соотношения липид/пептид от 40:1 до 15:1 происходит рост вклада этой составляющей от ~15% до ~50%. Также стоит отметить что начиная с соотношения липид/пептид 30:1 становится значительным вклад от изотропной составляющей, которая соответствует разрушенным липосомам. Величина этой составляющей растёт пропорционально количеству добавленного пептида и достигает значений 3-4%.

При рН 7 картина взаимодействия существенно иная: Во всём изученном диапазоне значений липид/пептид(от 50 до 15) не наблюдалось формирование дополнительных состояний модельного липидного бислоя. В то время как наблюдалось небольшое изменение параметров эластичности бислоя.

Таким образом, анализ влияния пептида на бислои ДОФГ при выбранных значениях рН подтверждает предположение о существенной роли ионогенного сотояния состояния остатка Glu11 во взаимодействии пептида слияния этого типа с липидным бислоем.

Благодарность:

Выражаем признательность РФФИ за финансовую поддержку, грант № 02-48882.

СПИСОК ЛИТЕРАТУРЫ

  1. Dubovskii, P.V., Li, H., Takahashi, S., Arseniev, A.S., and Akasaka, K.Protein Sci., 2000 V. 9, P. 786-798.
  2. Seelig J. Biochim. Biophys. Acta. 1978. V. 515. P. 105-140.
  3. Brumm T., Mops A., Dolainsky C., Bruckner S., Bayerl T.M. Biophys. J. 1992. V. 61. P. 1018-1024.
  4. Dubovskii P.V., Lesovoy D.M., Dubinnyi M.A., Utkin Y.N., Arseniev A.S. // Eur. J. Biochem. 2003. V. 270. P. 2038-2046.



Отзывы (через Facebook):

Оставить отзыв с помощью аккаунта FaceBook:

МОТОВИЛОВ КОНСТАНТИН ЯКОВЛЕВИЧ

Статья в формате PDF 215 KB...

24 11 2020 10:47:47

МИКРОЭКОЛОГИЯ ЧЕЛОВЕКА (ЧАСТЬ II)

С экологических позиций излагается представление о человеке как метасистеме, состоящей из макроскопического (тело) и микроскопического (микробиота) компонентов. Последний определяется как биоценоз микроорганизмов — бактерий, простейших, микроскопических грибов и вирусов, встречающийся у здоровых людей. Приводятся некоторые количественные характеристики микробиоты человека: общее число микроорганизмов, суммарная биомасса, процентное содержание облигатной, факультативной и транзиторной составляющих, время, за которое происходит смена генерации микроорганизмов. Рассматриваются главные системоообразующие факторы, обеспечивающие целостность микробиоты: структурный, метаболический, генетический и информационный. Анализируются взаимоотношения микробиоты и макроорганизма в нормальных физиологических условиях и при патологии. Обсуждаются механизмы развития дисбиозов и патогенетически обоснованные подходы к их коррекции. ...

20 11 2020 23:13:34

СОВРЕМЕННЫЕ ТЕНДЕНЦИИ В БАНКОВСКОМ ДЕЛЕ

Статья в формате PDF 256 KB...

18 11 2020 7:38:49

ОБЪЕКТ И ПРЕДМЕТ НАУКИ

Статья в формате PDF 129 KB...

16 11 2020 22:52:37

КЛИНИКО-ЭКСПЕРИМЕНТАЛЬНЫЕ АСПЕКТЫ ИЗУЧЕНИЯ ГЕМОРРАГИЧЕСКОГО СИНДРОМА ПРИ ЦИРРОЗАХ ПЕЧЕНИ

Статья посвящена современным проблемам гепатоэетерологии, в частности геморрагическому синдрому при заболеваниях печени. Основное место уделено алкогольным поражением печени. В статье присутствуют материалы посвященные изучению системы гемостаза, являющиеся сложной и актуальной проблемой в настоящее время. ...

13 11 2020 21:46:31

БИОХИМИЯ КРОВИ (учебное пособие)

Статья в формате PDF 106 KB...

11 11 2020 11:51:31

ЭНДОЭКОЛОГИЯ И ПРОБЛЕМА ПЕКТИНА

Статья в формате PDF 244 KB...

10 11 2020 15:12:47

СУБТРОПИЧЕСКИЕ РАСТЕНИЯ ФЛОРЫ КАВКАЗА

Статья в формате PDF 121 KB...

09 11 2020 4:12:29

ИЗМЕНЕНИЕ ПОКАЗАТЕЛЕЙ РАБОТЫ СЕРДЦА СТУДЕНТОВ В ТЕЧЕНИИ СЕМЕСТРА В РАЗНЫЕ ДНИ НЕДЕЛИ

Исследованы показатели сердечнососудистой системы (систолическое, диастолическое давление, частота сердечных сокращений, пульсовое давление и минутный объем крови) у студентов обоего пола среднего учебного заведения в условиях учебной нагрузки до и после занятий в разные дни недели в начале и конце семестра. Возраст участников исследования составлял 18–20 лет. При анализе результатов выявлены половые и циркосептальные особенности реакции сердечнососудистой системы на учебную нагрузку. Было установлено, что в течение недели после учебной нагрузки происходит снижение артериального давления, особенно у девушек, причем в начале семестра изменения в большей степени выражены в первой половине недели. Результаты свидетельствуют о развитии утомления и снижении адаптационных процессов, что необходимо учитывать при составлении расписания занятий и планировании учебной нагрузки. ...

08 11 2020 12:26:25

ЛИТЕРАТУРНОЕ ОБРАЗОВАНИЕ ДЕТЕЙ: КРИЗИС ЧТЕНИЯ

Статья в формате PDF 265 KB...

06 11 2020 23:19:12

ПСИХОСОМАТИЧЕСКИЙ ПОДХОД В ГЕРОНТОПСИХИАТРИИ

Статья в формате PDF 95 KB...

05 11 2020 10:26:53

ПРОГНОЗ ВВП РОССИИ ЗА 2007 ГОД С УЧЕТОМ ДАННЫХ LENTA.RU

Статья в формате PDF 91 KB...

03 11 2020 15:29:51

РОЛЬ ВОДЫ В ОСНОВНЫХ СТРУКТУРАХ ЖИВОГО ОРГАНИЗМА

Статья в формате PDF 950 KB...

26 10 2020 9:32:43

УНИВЕРСАЛЬНЫЙ ХАРАКТЕР РЕКУРРЕНТНЫХ ЗАВИСИМОСТЕЙ ФИЗИКО-ХИМИЧЕСКИХ СВОЙСТВ ОРГАНИЧЕСКИХ СОЕДИНЕНИЙ

Уникальные возможности линейных рекуррентных уравнений первого порядка А(n+1) = aA(n) + b позволяют характеризовать закономерности изменения различных свойств органических соединений ( А) не только в пределах локальных групп гомологов, но и одновременно всех рядов с одинаковыми гомологическими разностями. Более того, рекуррентные соотношения применимы к функциям не только целочисленных (число атомов углерода в молекуле), но и равноотстоящих значений аргументов A(x+Δx) = aA(x) + b, (Δx = const). Этот способ аппроксимации проиллюстрирован на примерах температурных зависимостей растворимости различных веществ в воде и даже времен релаксации в высокочастотных полях. ...

24 10 2020 3:24:48

ЛАЗЕРНОЕ ЛЕГИРОВАНИЕ ПОВЕРХНОСТИ ТИТАНА МЕДЬЮ

Статья в формате PDF 111 KB...

23 10 2020 15:38:14

Селицкий Александр Яковлевич

Статья в формате PDF 70 KB...

10 10 2020 19:54:27

ЛИЧНОСТНО – ОРИЕНТИРОВАННОЕ ОБУЧЕНИЕ – РАЗВИВАЮЩИЙ ПОТЕНЦИАЛ ЕСТЕСТВЕННО – НАУЧНОГО ОБРАЗОВАНИЯ

Личностно – ориентированная технология ставит в центр образовательной системы личность, которая стремится к максимальной реализации своих возможностей. Основными понятиями в личностно – ориентированном учении является обучение и развитие ученика в процессе педагогики сотрудничества. ...

07 10 2020 16:29:19

ЗНАЧЕНИЕ РЕШЕНИЯ ЗАДАЧ ПРИ ОБУЧЕНИИ ФИЗИКЕ

Статья в формате PDF 312 KB...

06 10 2020 8:29:12

ОПРЕДЕЛЕНИЕ ФАКТОРОВ РИСКА АТЕРОСКЛЕРОЗА

Статья в формате PDF 114 KB...

05 10 2020 13:20:28

ОСОБЕННОСТИ ГУМУСООБРАЗОВАНИЯ В СТЕПНОЙ ЗОНЕ ТУВЫ

Статья в формате PDF 232 KB...

29 09 2020 11:27:47

МЕТОДЫ УПРОЧНЕНИЯ ИОННО-ПЛАЗМЕННОЙ ОБРАБОТКОЙ

Статья в формате PDF 259 KB...

25 09 2020 11:39:29

АКСИОЛОГИЧЕСКИЕ АСПЕКТЫ ЗДОРОВОГО ОБРАЗА ЖИЗНИ

Статья в формате PDF 119 KB...

08 09 2020 4:15:30

ТЕРАПЕВТИЧЕСКАЯ ИГРА КАК МЕТОД ОБУЧЕНИЯ ПАЦИЕНТОВ

Статья в формате PDF 241 KB...

07 09 2020 15:33:18

ЮРЬЕВ АЛЕКСАНДР ГАВРИЛОВИЧ

Статья в формате PDF 320 KB...

04 09 2020 21:21:30

АТОМНАЯ ЭНЕРГЕТИКА В РОССИИ СЕГОДНЯ

Статья в формате PDF 87 KB...

27 08 2020 23:28:49

БИОХИМИЧЕСКИЙ АНАЛИЗ КРОВИ КРЫС ПРИ ХРОНИЧЕСКОМ ОТРАВЛЕНИИ СОЛЯМИ МОЛИБДЕНА И ХРОМА

При хроническом отравлении солями молибдена и хрома определены функциональные нарушения у экспериментальных животных. Изменения в плазме крови выявили нарушения желудочно-кишечного тракта, печени, почек, сердечной мышцы крыс. ...

26 08 2020 13:25:44

ОПЕРЕЖАЮЩЕЕ АНТИКРИЗИСНОЕ УПРАВЛЕНИЕ ПРЕДПРИЯТИЕМ

В статье исследованы некоторые проблемы опережающего антикризисного управления предприятием. ...

23 08 2020 12:23:22

ВЫВОД УРАВНЕНИЙ МАКСВЕЛЛА ИЗ ФУНКЦИИ СОСТОЯНИЯ. ЗАРЯДОВАЯ ФУНКЦИЯ СОСТОЯНИЯ И ЕЁ СВЯЗЬ С ЗАКОНОМ СОХРАНЕНИЯ ЗАРЯДА

На основе введённых функций состояния для электромагнитного поля и зарядовой функции состояния для частиц выведена полная система уравнений Максвелла для электродинамики. Показано, что закон сохранения зарядов есть следствие существования этой функции. Показано также, что в вакууме электромагнитное поле отсутствует, что подтверждает справедливость теории дальнодействия. ...

20 08 2020 2:42:35

ЦИФРОВОЙ МОДЕМ ДЛЯ СЕТИ ISDN

Статья в формате PDF 297 KB...

18 08 2020 20:26:11

К ВОПРОСУ ИССЛЕДОВАНИЯ ВЛИЯНИЯ АТМОСФЕРНОГО ДАВЛЕНИЯ, ОТНОСИТЕЛЬНОЙ ВЛАЖНОСТИ И ТЕМПЕРАТУРЫ ВОЗДУХА НА ДАВЛЕНИЕ ВОЗДУХА В ШИНЕ ЛЕГКОВОГО АВТОМОБИЛЯ

Исследованы вопросы влияния давления, относительной влажности и температуры атмосферы на давление воздуха в шине 175/70R13 легкового автомобиля В А З на основании данных Г У « В Н И И Г М И- М Ц Д» по постам (станциям) о температуре воздуха, относительной влажности и атмосферном давлении на уровне станции по природно – климатическим поясам России. Вопросы влияния климатических характеристик на давление в автомобильных шинах рассмотрены для летнего периода, который является наиболее нагруженным в году периодом в плане эксплуатации автомобиля. Исследования выполнены методом случайной выборки с использованием данных срочных наблюдений по постам Федеральной службы по гидрометеорологии и мониторингу окружающей среды. Изменения давления в шине в течение рабочей смены значительно влияют на управляемость, надежность и экономическую эффективность эксплуатации автотранспорта. ...

17 08 2020 8:59:58

РОЛЬ МСФО В РОССИИ

Статья в формате PDF 133 KB...

16 08 2020 5:29:33

ЭКОНОМИЧЕСКИЕ ВОПРОСЫ РЕМОНТА БЫТОВОЙ ТЕХНИКИ

В статье показано, что ремонт бытовой техники в зависимости от сложности и условий эксплуатации подразделяется на ремонт непосредственно на дому у заказчика, ремонт в мастерской. Ремонт на дому у заказчика связан с выполнением мелкого и среднего ремонта, т.е. когда ремонт технически возможен и экономически целесообразен. Ремонт в мастерской выполняется тогда, когда невозможно его выполнить в домашних условиях. Кроме того , ремонт бывает в гарантийный период и в послегарантийный периоды эксплуатации. Во всех случаях оплата за ремонт осуществляется по своим правилам, ...

04 08 2020 2:49:15

ЭКОЛОГИЯ ГОРОДА

Статья в формате PDF 84 KB...

03 08 2020 22:54:30

СЕТЕВЫЕ ТЕЛЕКОММУНИКАЦИОННЫЕ ПРОЕКТЫ КАК ФОРМА РАБОТЫ С ОДАРЕННЫМИ УЧАЩИМИСЯ ПРИ ИЗУЧЕНИИ ГЕОГРАФИИ

Учебный предмет география состоит из двух блоков. Физическая география изучает элементы природы как единое целое, формирует “образ территории”. Социально-экономическая география рассматривает развитие общества и экономики в тесной взаимосвязи с природными условиями. Для формирования и поддержания интереса к географии в Ф Т Л № 1 широко используются современные информационные технологии. Компьютерное тестирование систематически используется на уроках. Лицеисты успешно участвуют в различных телекоммуникационных олимпиадах - индивидуальных и групповых конкурсах с использованием электронной почты и сети Интернет. Такие проекты развивают умение работать с различными источниками информации, способствуют межпредметной интеграции знаний и формированию целостной картины мира. ...

02 08 2020 11:15:44

ПУТИ ИСПОЛЬЗОВАНИЯ СЕМЯН ОБЛЕПИХИ НА ПИЩЕВЫЕ ЦЕЛИ

Статья в формате PDF 100 KB...

30 07 2020 1:47:10

ПЕДАГОГИЧЕСКОЕ СОПРОВОЖДЕНИЕ ОДАРЁННЫХ ДЕТЕЙ

В настояще время весьма актуальной является задача поиска, отбора, поддержки и развития интеллектуально одарённых детей. « Трёхкольцевая модель одарённости» Рензулли включает следующие компоненты: высокий уровень интеллекта, креативность и усиленную мотивацию. Такие дети требуют дифференцированных учебных программ и особой педагогической поддержки. В современной практике обучения используются педагогические стратегии и программы, которые предусматривают высокий уровень развития мыслительных процессов, совершенствование творческих способностей и быстрое усвоение знаний, умений и навыков. Процесс обучения одарённых детей требует создания особой образовательной среды. Ключевой фигурой в создании такой среды является учитель. Функция педагога состоит в сопровождении и поддержке, развитии личности ученика. Продуктивность взаимодействий обеспечивается включённостью ученика и учителя в общую целенаправленную деятельность. ...

28 07 2020 20:33:51

О НЕКОТОРЫХ ПРОБЛЕМАХ МОЛОДОЙ КАРЕЛЬСКОЙ ПИСЬМЕННОСТИ

Статья посвящена проблемам становления новейшей лексики и орфографии новописьменного карельского языка. В статье отражены современные процессы развития лексикона, а также представлена к решению проблема так называемых послеложных падежей (элатива, аблатива, комитатива, аппроксиматива и терминатива). ...

27 07 2020 12:59:24

ЭКОЛОГИЯ И ПАРАЗИТАРНЫЕ ЗАБОЛЕВАНИЯ У ДЕТЕЙ

Статья в формате PDF 125 KB...

22 07 2020 5:30:27

РОЛЬ АУДИТОРИИ В УЧЕБНОМ ПРОЦЕССЕ

Статья в формате PDF 108 KB...

20 07 2020 11:38:36

БИОЛОГИЯ И ПРОБЛЕМЫ ОХРАНЫ СУРКОВ В КУЗБАССЕ

Статья в формате PDF 112 KB...

18 07 2020 18:47:39

Максимальная скорость окисления оксида азота

Статья в формате PDF 344 KB...

16 07 2020 6:54:18

ФОРМИРОВАНИЕ СОВРЕМЕННОЙ ИНТЕЛЛИГЕНЦИИ В УСЛОВИЯХ СТАНОВЛЕНИЯ ИНТЕЛЛЕКТУАЛЬНОЙ СОБСТВЕННОСТИ

В настоящее время одной из наиболее обсуждаемых является тема воздействия интеллигенции на общественно-экономическую жизнь. Интеллигенция, являясь наиболее образованной группой общества, является монополистом в области на духовного и интеллектуального производства. По мере ускорения научно-технического прогресса данная тенденция усиливается. ...

09 07 2020 0:53:55

ГАСТРОЭЗОФАГЕАЛЬНАЯ РЕФЛЮКСНАЯ БОЛЕЗНЬ И ПИЩЕВОД БАРРЕТТА: КЛИНИКО-ИММУНОЛОГИЧЕСКИЕ ПАРАЛЛЕЛИ

Цель исследования - изучение особенностей клеточного звена иммунитета и содержания цитокинов в сыворотке крови у пациентов с гастроэзофагеальной рефлюксной болезнью и пищеводом Барретта. Обследованы 70 пациентов с эрозивной формой гастроэзофагеальной рефлюксной болезни и 42 пациента с пищеводом Барретта. Применены клинические, эндоскопические, морфологические, иммунологические методы исследования. Выявлены различия в показателях клеточного звена иммунитета и содержания в сыворотке крови интерлейкина-4, интерлейкина-8, интерлейкина-10, фактора некроза опухолей-, интерферона- у больных гастроэзофагеальной рефлюксной болезнью в динамике лечения и у пациентов с пищеводом Барретта. ...

04 07 2020 3:47:46

Еще:
Обзоры -1 :: Обзоры -2 :: Обзоры -3 :: Обзоры -4 :: Обзоры -5 :: Обзоры -6 :: Обзоры -7 :: Обзоры -8 :: Обзоры -9 :: Обзоры -10 :: Обзоры -11 ::

Последовательность подготовки научной работы может быть такой:

Выбор темы. Это важный этап. Во-первых, тема должна быть интересна не только вам, но и большинству слушателей, которым вы будете её докладывать, чтобы вы видели заинтересованность в их глазах, а не откровенную скуку.

Выбор целей и задач своей научной работы. То есть, нужно сузить тему. Например, тема: «Грудное вскармливание», сужение темы: «Грудное вскармливание среди студенток нашего ВУЗа». И если общая тема мало кому интересна, то суженная до рамок собственного института или университета, она становится интересной практически для всех слушателей. Целью может стать: «Содействие оптимальным условиям вскармливания грудью детей студентов нашего ВУЗа», а задачей — доказать, что специальные условия, созданные для кормящих студенток, не помешают их успеваемости, но уменьшат количество пропусков, академических отпусков и способствуют выращиванию здоровых детей — нашего будущего. Понятно, что эта тема подходит для студентов медицинских и педагогических ВУЗов, но и в других учебных учреждениях можно найти темы, интересные всем.

Разработать методы исследования и сбора информации. В случае с естественным вскармливанием, скорее всего, это будет анкетирование студенток, имеющих детей.

Систематизировать материал и подготовить презентацию.

Подготовиться к выступлению.

Выступить и получить: награду, удовольствие и опыт, чтобы в следующем году выступить ещё лучше и сорвать шквал аплодисментов, стать узнаваемым, а значит — более конкурентоспособным!