IT-Reviews    

ВЗАИМОДЕЙСТВИЕ АНАЛОГА ПЕПТИДА СЛИЯНИЯ ИЗ ГЕМАГГЛЮТИНИНА ВИРУСА ГРИППА С ФОСФОЛИПИДНЫМИ ЛИПОСОМАМИ: ИЗУЧЕНИЕ МЕТОДОМ 31Р-ЯМР

Рекомендуем: фильм Запрещенный прием (Россия) - пересказ сюжета, спойлеры
Источник:
Лесовой Д.М. Жмак М.Н. Люкманова Е.Н. Дубовский П.В. Статья в формате PDF 112 KB

Пептиды слияния - фрагменты вирусных белков, состоящие из 20-25 аминокислот, способные вызывать слияние липидных и биологических мембран [1]. При изучении этих процессов удобно работать с водорастворимыми аналогами. Нами сконструирован аналог F31, состоящий из 31-го аминокислотного остатка: glfgaiagfieggwtgmidgwygygggkkkk.

С-концевой фрагмент GCGKKK обеспечивает водорастворимостиь пептида, а N-концевая часть (остатки 1-24) соответствует пептиду слияния из гемагглютинина (штамм A/PR/8/34). В пептиде имеется только один остаток глутаминовой кислоты (Glu11). Цель данной работы - изучить влияние пептида F31 на фосфолипидные липосомы при различных состояниях ионизации этого остатка. С учётом данных по величинам рКа остатков Glu в пептидах слияния, находящихся в мембранном окружении, есть основания считать, что при изменении рН от 7 до 4 с большой долей вероятности происходит протонирование боковой карбоксильной группы этого остатка. Поэтому нами взяты эти значения рН как такие, при которых остаток полностью заряжен (рН 7) и нейтрален (рН 4), соответственно. Фосфолипидные липосомы формировались из анионного фосфолипида диолеоилфосфатидилглицерина (ДОФГ). Т.к. заряд пептида в целом положителен при обоих значениях рН (4 и 7), это обеспечивает эффективное связывание с пловерхностью липосом за счёт электростатического притяжения. Следовательно, изменение характера вляиния пептида на липосомы при изменении рн от 7 до 4 будет означать изменение характера гидрофобного взаимодействия пептида с липосомами, вероятно, за счёт изменения глубины проникновения пептида в фосфолипидный бислой и/или характера ассоции пептидов на липосомах.

Наиболее удобным методом для исследования взаимодействий липид/пептид является метод 31P-ЯМР спектроскопии широких линий. Данный метод позволяет работать с бислойными мультиламеллярными липосомами, которые более адекватно моделирует биологическую мембрану. Показано, что форма линии 31P-ЯМР спектров мембран чувствительна к анизотропным движениям молекул фосфолипидов[2, 3], что позволяет следить за изменениями состояния модельной мембраны под воздействием пептида.

Для изучения рН-зависимости взаимодействия были проведены серии экспериментов при рН 4 и 7. Проанализировав полученные 31Р-ЯМР спектры с помощью разработанной нами программы P-FIT [4], были получены зависимости параметров, характеризующих состояние бислоя в зависимости от соотношения липид/пептид.

При рН 4 наблюдается значительное влияние пептида на состояние бислоя. Так, при последовательном добавлении пептида, начиная с соотношения липид/пептид 40:1 происходит формирование второй анизотропной составляющей. Данная составляющая характеризуется уменьшенным значением анизотропии химического сдвига а также уменьшенным значением степени деформации липосом магнитным полем спектрометра, что связано с уменьшением эластичности мембраны. При уменьшением соотношения липид/пептид от 40:1 до 15:1 происходит рост вклада этой составляющей от ~15% до ~50%. Также стоит отметить что начиная с соотношения липид/пептид 30:1 становится значительным вклад от изотропной составляющей, которая соответствует разрушенным липосомам. Величина этой составляющей растёт пропорционально количеству добавленного пептида и достигает значений 3-4%.

При рН 7 картина взаимодействия существенно иная: Во всём изученном диапазоне значений липид/пептид(от 50 до 15) не наблюдалось формирование дополнительных состояний модельного липидного бислоя. В то время как наблюдалось небольшое изменение параметров эластичности бислоя.

Таким образом, анализ влияния пептида на бислои ДОФГ при выбранных значениях рН подтверждает предположение о существенной роли ионогенного сотояния состояния остатка Glu11 во взаимодействии пептида слияния этого типа с липидным бислоем.

Благодарность:

Выражаем признательность РФФИ за финансовую поддержку, грант № 02-48882.

СПИСОК ЛИТЕРАТУРЫ

  1. Dubovskii, P.V., Li, H., Takahashi, S., Arseniev, A.S., and Akasaka, K.Protein Sci., 2000 V. 9, P. 786-798.
  2. Seelig J. Biochim. Biophys. Acta. 1978. V. 515. P. 105-140.
  3. Brumm T., Mops A., Dolainsky C., Bruckner S., Bayerl T.M. Biophys. J. 1992. V. 61. P. 1018-1024.
  4. Dubovskii P.V., Lesovoy D.M., Dubinnyi M.A., Utkin Y.N., Arseniev A.S. // Eur. J. Biochem. 2003. V. 270. P. 2038-2046.



Отзывы (через Facebook):

Оставить отзыв с помощью аккаунта FaceBook:

СТУК ИЗ ПРОШЛОГО

Статья в формате PDF 257 KB...

26 04 2021 5:44:41

АКТИВНОСТЬ ФОСФОЛИПАЗЫ А2 И СОСТОЯНИЕ ПРОЦЕССОВ ПЕРЕКИСНОГО ОКИСЛЕНИЯ ЛИПИДОВ В ПЕРИФЕРИЧЕСКОЙ КРОВИ У БЕРЕМЕННЫХ С ГЕРПЕС-ВИРУСНОЙ ИНФЕКЦИЕЙ

В работе изучено состояние процессов перекисного окисления липидов и содержание фосфолипазы А2 в периферической крови беременных III триместра с обострением герпес-вирусной инфекции в зависимости от титра антител IgG к вирусу простого герпеса 1 типа. Установлено, что обострение герпес-вирусной инфекции в период гестации способствует активации процессов перекисного окисления липидов, регистрируемого по содержанию Т Б К-активных продуктов (малонового диальдегида), повышению содержания фосфолипазы А2, наиболее выраженное при титре антител IgG к В П Г-1 1:12800 и является причиной деструктивных процессов в составе липидов эритроцитов. ...

24 04 2021 22:44:57

ОСНОВЫ МЕНЕДЖМЕНТА

Статья в формате PDF 279 KB...

23 04 2021 23:10:28

ДИПЛОМНОЕ ПРОЕКТИРОВАНИЕ (учебное пособие)

Статья в формате PDF 97 KB...

22 04 2021 22:29:29

Загиров Умарасхаб Загирович

Статья в формате PDF 65 KB...

19 04 2021 8:20:25

ПРОБЛЕМА ФОРМИРОВАНИЯ КОМПЕТЕНТНОСТЕЙ В УЧЕБНО-ВОСПИТАТЕЛЬНОМ ПРОЦЕССЕ НАЧАЛЬНОЙ ШКОЛЫ

Стратегия социально-экономического развития Р Ф поставило на государственном уровне вопрос о достижении нового качества общего образования – готовности и способности учащихся к непрерывному образованию. В настоящее время в соответствии с основными тенденциями развития современного образования меняются целевые, процессуальные и результативные компоненты учебно-воспитательного процесса и прежде всего в начальной школе. ...

12 04 2021 7:44:29

РАЗВИТИЕ ЛЕСНОГО КОМПЛЕКСА В РОССИИ

Статья в формате PDF 314 KB...

07 04 2021 20:16:55

НОВООБРАЗОВАНИЯ ТОЛСТОЙ КИШКИ

Статья в формате PDF 105 KB...

02 04 2021 9:31:29

Я И МОЁ ЗДОРОВЬЕ

В статье излагается позиция автора о необходимости максимально ответственно относиться к своему здоровью, исходя из объективных предпосылок нашего времени. ...

30 03 2021 12:29:59

ТРАНСФОРМАЦИЯ НАСЕЛЕНИЯ ОХОТНИЧЬЕ-ПРОМЫСЛОВЫХ МЛЕКОПИТАЮЩИХ ПРИ ОСВОЕНИИ ЧАЯНДИНСКОГО ЛИЦЕНЗИОННОГО УЧАСТКА (ЗАПАДНАЯ ЯКУТИЯ)

В сообщении представлены сведения о трансформации населения охотничье-промысловых млекопитающих при освоении Чаяндинского лицензионного участка ( Западная Якутия). Материалы собраны в 2009–2011 гг. В результате проведенных учетных работ и опросных сведений на территории лицензионного участка выявлено обитание 10 видов охотничье-промысловых млекопитающих из 20 видов, обитающих на территории Западной Якутии. На настоящий момент существенных изменений численности охотничье-промысловых животных на лицензионном участке не происходит. В целом воздействие геологоразведочных работ на нефть и газ носят локальный характер. ...

27 03 2021 9:15:46

ДИНАМИЧЕСКАЯ МОДЕЛЬ КОНКУРЕНЦИИ ДВУХ ФИРМ НА ОДНОРОДНОМ РЫНКЕ

Рассмотрена экономико-математическая модель конкуренции двух фирм на однородном рынке сбыта. Приводится формулировка соответствующей задачи Коши для системы обыкновенных дифференциальных уравнений первого порядка, описывающей динамику развития системы, которая может быть легко обобщена на случай произвольного количества конкурирующих предприятий. Дана экономическая интерпретация полученных результатов. ...

25 03 2021 14:43:52

ПОЦЕЛУЕВА ЛЮДМИЛА АЛЕКСАНДРОВНА

Статья в формате PDF 109 KB...

21 03 2021 11:40:59

ВЛИЯНИЕ БИОПРЕПАРАТОВ НА ФОТОСИНТЕТИЧЕСКИЙ ПОТЕНЦИАЛ И ПРОДУКТИВНОСТЬ РАННИХ ГИБРИДОВ ОГУРЦА В ПЛЕНОЧНОЙ ТЕПЛИЦЕ

Установлено, что применение биопрепаратов биогумус, гуми и альбит при замачивании семян и некорневой подкормке раннеспелых гибридов огурца в пленочной теплице, положительно влияют на энергию прорастания и всхожесть семян, ускоряют рост и развитие растений огурца, сокращают межфазный период на 3- 4 дня, вегетационный период, на 5-6 дней. Благоприятно влияют на водный режим растений, увеличение ассимиляционной поверхности, фотосинтетический потенциал и урожайность. Наиболее эффективное действие оказывали биопрепараты биогумус и гумми на гибридах, отечественной селекции Арина и голландской Машенька. ...

20 03 2021 12:59:36

ПЕДАГОГИЧЕСКИЙ ТЕКСТ КАК ЭЛЕМЕНТ ОБУЧЕНИЯ

Статья в формате PDF 132 KB...

18 03 2021 17:52:47

СЕМЬЯ УЛЬЯНОВЫХ И БЛАГОТВОРИТЕЛЬНОСТЬ

Статья в формате PDF 140 KB...

14 03 2021 12:27:25

ПСИХОЛОГИЯ И ПЕДАГОГИКА (учебное пособие)

Статья в формате PDF 107 KB...

13 03 2021 21:25:11

PROBLEMS OF BIOCHEMICAL INDICATION OF STATUS OF FISHES OF NORTH BASIN

Статья в формате PDF 127 KB...

11 03 2021 21:30:11

ЦИФРОВАЯ ОБРАБОТКА ИЗОБРАЖЕНИЙ

Статья в формате PDF 261 KB...

11 02 2021 15:53:32

Статистические закономерности хронологии космонавтики

В статье описана и исследована методами математической статистики хронологическая аномалия космонавтики. Обоснован биномиальный закон распределения числа хронологических совпадений. Показано, что вероятность случайного появления рассматриваемых совпадений весьма мала. Метод исследования, применяемый в работе, преимущественно основан на статистическом анализе хронологии при помощи параметризации дат событий и проверки соответствующего критериального свойства. Используются параметры: условные номера дней с начала летоисчисления N, с начала года n и год Г. Основными информативными параметрами являются интервалы времени между событиями. Обоснован биномиальный закон распределения числа хронологических совпадений. Показано, что вероятность случайного появления рассматриваемых совпадений весьма мала. ...

10 02 2021 5:32:20

ВИНДЖАММЕРЫ – «ВЫЖИМАТЕЛИ ВЕТРА»

Статья в формате PDF 412 KB...

09 02 2021 3:23:46

ШОШОНИТОВЫЕ ГРАНИТОИДЫ ТИГИРЕКСКОГО МАССИВА АЛТАЯ: ГЕОХИМИЯ, ПЕТРОЛОГИЯ И РУДОНОСНОСТЬ

риведены геологические, геохимические и петрологические данные по шошонитовым гранитоидам Тигирекского массива Алтая. В составе массива выделены 5 фаз: 1 – габбро; 2 – диориты, монцодиориты; 3 − сиениты, гранодиориты, граносиениты; 4 – граниты, умеренно-щелочные граниты; 5 – лейкограниты, умеренно-щелочные лейкограниты с флюоритом. Породные типы массива отнесены к нормальной известково-щелочной и высококалиевой шошонитовой сериям. Сиениты и монцодиориты тяготеют по составу к банакитам. В процессе становления массива проихсодила диффреренциация глубинного очага с фракционированием редкоземельных элементов, что отразилось на соотношении в породах элементов групп LILE и HFSE со значительной деплетированностью последних. В породах происходила смена типа тетрадного фракционрования редкоземельных элементов, что связано с различной насыщенностью расплавов флюидами и летучимим компонентами. С массивом связаны месторождения и проявления железа, вольфрамаа, молибдена, бериллия, аквамарина, горного хрусталя и раухтопаза. ...

02 02 2021 14:12:38

Молекулы средней массы плазмы крови при сифилисе

Статья в формате PDF 106 KB...

01 02 2021 21:51:14

ДЕРМАЛЬНЫЕ ФИБРОБЛАСТЫ И СТАРЕНИЕ КОЖИ ЧЕЛОВЕКА

Статья в формате PDF 145 KB...

28 01 2021 8:55:16

Пимнева Людмила Анатольевна

Статья в формате PDF 148 KB...

26 01 2021 13:44:52

СОВРЕМЕННЫЕ ПРОБЛЕМЫ ДИДАКТИКИ ВЫСШЕЙ ШКОЛЫ

Статья в формате PDF 164 KB...

25 01 2021 19:58:27

ОСОБЕННОСТИ ФОРМИРОВАНИЯ ВЕГЕТАТИВНОГО ГОМЕОСТАЗА У ДЕТЕЙ ШКОЛЬНОГО ВОЗРАСТА В РАЗЛИЧНЫХ РЕГИОНАХ СИБИРИ

С целью изучения экологических и этнических особенностей адаптационно-компенсаторных механизмов у детей различных популяционных групп были обследованы 208 школьников 7-15 лет, проживающие в г. Красноярске и в Эвенкии. Проведена комплексная клинико-инструментальная оценка вегетативного статуса по показателям кардиоинтервалографии с клиноортостатической пробой. Показано, что в популяции жителей Эвенкии этническая принадлежность (дети эвенков) является одним из факторов, формирующих вегетативный гомеостаз. Они отличаются от детей пришлого населения Эвенкии по напряжению вегетативных механизмов регуляции. Полученные результаты необходимы для разработки региональных критериев здоровья, проведения коррекционных и профилактических мероприятий на донозологическом этапе. ...

08 01 2021 15:21:48

АНТИЦИПАТИВНЫЙ АНТИКРИЗИСНЫЙ МАРКЕТИНГ

Статья в формате PDF 342 KB...

28 12 2020 17:46:26

ЭКСПЕРТНО-ОБУЧАЮЩИЕ СИСТЕМЫ В ОБРАЗОВАНИИ

Статья в формате PDF 310 KB...

27 12 2020 17:30:29

МОДУЛЬНЫЕ ТЕХНОЛОГИИ РЕАЛИЗАЦИИ УЧЕБНОГО ПРОЦЕССА

Статья в формате PDF 169 KB...

19 12 2020 10:23:26

Еще:
Обзоры -1 :: Обзоры -2 :: Обзоры -3 :: Обзоры -4 :: Обзоры -5 :: Обзоры -6 :: Обзоры -7 :: Обзоры -8 :: Обзоры -9 :: Обзоры -10 :: Обзоры -11 ::

Последовательность подготовки научной работы может быть такой:

Выбор темы. Это важный этап. Во-первых, тема должна быть интересна не только вам, но и большинству слушателей, которым вы будете её докладывать, чтобы вы видели заинтересованность в их глазах, а не откровенную скуку.

Выбор целей и задач своей научной работы. То есть, нужно сузить тему. Например, тема: «Грудное вскармливание», сужение темы: «Грудное вскармливание среди студенток нашего ВУЗа». И если общая тема мало кому интересна, то суженная до рамок собственного института или университета, она становится интересной практически для всех слушателей. Целью может стать: «Содействие оптимальным условиям вскармливания грудью детей студентов нашего ВУЗа», а задачей — доказать, что специальные условия, созданные для кормящих студенток, не помешают их успеваемости, но уменьшат количество пропусков, академических отпусков и способствуют выращиванию здоровых детей — нашего будущего. Понятно, что эта тема подходит для студентов медицинских и педагогических ВУЗов, но и в других учебных учреждениях можно найти темы, интересные всем.

Разработать методы исследования и сбора информации. В случае с естественным вскармливанием, скорее всего, это будет анкетирование студенток, имеющих детей.

Систематизировать материал и подготовить презентацию.

Подготовиться к выступлению.

Выступить и получить: награду, удовольствие и опыт, чтобы в следующем году выступить ещё лучше и сорвать шквал аплодисментов, стать узнаваемым, а значит — более конкурентоспособным!