IT-Reviews    

ВЗАИМОДЕЙСТВИЕ АНАЛОГА ПЕПТИДА СЛИЯНИЯ ИЗ ГЕМАГГЛЮТИНИНА ВИРУСА ГРИППА С ФОСФОЛИПИДНЫМИ ЛИПОСОМАМИ: ИЗУЧЕНИЕ МЕТОДОМ 31Р-ЯМР

Лесовой Д.М. Жмак М.Н. Люкманова Е.Н. Дубовский П.В. Статья в формате PDF 112 KB

Пептиды слияния - фрагменты вирусных белков, состоящие из 20-25 аминокислот, способные вызывать слияние липидных и биологических мембран [1]. При изучении этих процессов удобно работать с водорастворимыми аналогами. Нами сконструирован аналог F31, состоящий из 31-го аминокислотного остатка: glfgaiagfieggwtgmidgwygygggkkkk.

С-концевой фрагмент GCGKKK обеспечивает водорастворимостиь пептида, а N-концевая часть (остатки 1-24) соответствует пептиду слияния из гемагглютинина (штамм A/PR/8/34). В пептиде имеется только один остаток глутаминовой кислоты (Glu11). Цель данной работы - изучить влияние пептида F31 на фосфолипидные липосомы при различных состояниях ионизации этого остатка. С учётом данных по величинам рКа остатков Glu в пептидах слияния, находящихся в мембранном окружении, есть основания считать, что при изменении рН от 7 до 4 с большой долей вероятности происходит протонирование боковой карбоксильной группы этого остатка. Поэтому нами взяты эти значения рН как такие, при которых остаток полностью заряжен (рН 7) и нейтрален (рН 4), соответственно. Фосфолипидные липосомы формировались из анионного фосфолипида диолеоилфосфатидилглицерина (ДОФГ). Т.к. заряд пептида в целом положителен при обоих значениях рН (4 и 7), это обеспечивает эффективное связывание с пловерхностью липосом за счёт электростатического притяжения. Следовательно, изменение характера вляиния пептида на липосомы при изменении рн от 7 до 4 будет означать изменение характера гидрофобного взаимодействия пептида с липосомами, вероятно, за счёт изменения глубины проникновения пептида в фосфолипидный бислой и/или характера ассоции пептидов на липосомах.

Наиболее удобным методом для исследования взаимодействий липид/пептид является метод 31P-ЯМР спектроскопии широких линий. Данный метод позволяет работать с бислойными мультиламеллярными липосомами, которые более адекватно моделирует биологическую мембрану. Показано, что форма линии 31P-ЯМР спектров мембран чувствительна к анизотропным движениям молекул фосфолипидов[2, 3], что позволяет следить за изменениями состояния модельной мембраны под воздействием пептида.

Для изучения рН-зависимости взаимодействия были проведены серии экспериментов при рН 4 и 7. Проанализировав полученные 31Р-ЯМР спектры с помощью разработанной нами программы P-FIT [4], были получены зависимости параметров, характеризующих состояние бислоя в зависимости от соотношения липид/пептид.

При рН 4 наблюдается значительное влияние пептида на состояние бислоя. Так, при последовательном добавлении пептида, начиная с соотношения липид/пептид 40:1 происходит формирование второй анизотропной составляющей. Данная составляющая характеризуется уменьшенным значением анизотропии химического сдвига а также уменьшенным значением степени деформации липосом магнитным полем спектрометра, что связано с уменьшением эластичности мембраны. При уменьшением соотношения липид/пептид от 40:1 до 15:1 происходит рост вклада этой составляющей от ~15% до ~50%. Также стоит отметить что начиная с соотношения липид/пептид 30:1 становится значительным вклад от изотропной составляющей, которая соответствует разрушенным липосомам. Величина этой составляющей растёт пропорционально количеству добавленного пептида и достигает значений 3-4%.

При рН 7 картина взаимодействия существенно иная: Во всём изученном диапазоне значений липид/пептид(от 50 до 15) не наблюдалось формирование дополнительных состояний модельного липидного бислоя. В то время как наблюдалось небольшое изменение параметров эластичности бислоя.

Таким образом, анализ влияния пептида на бислои ДОФГ при выбранных значениях рН подтверждает предположение о существенной роли ионогенного сотояния состояния остатка Glu11 во взаимодействии пептида слияния этого типа с липидным бислоем.

Благодарность:

Выражаем признательность РФФИ за финансовую поддержку, грант № 02-48882.

СПИСОК ЛИТЕРАТУРЫ

  1. Dubovskii, P.V., Li, H., Takahashi, S., Arseniev, A.S., and Akasaka, K.Protein Sci., 2000 V. 9, P. 786-798.
  2. Seelig J. Biochim. Biophys. Acta. 1978. V. 515. P. 105-140.
  3. Brumm T., Mops A., Dolainsky C., Bruckner S., Bayerl T.M. Biophys. J. 1992. V. 61. P. 1018-1024.
  4. Dubovskii P.V., Lesovoy D.M., Dubinnyi M.A., Utkin Y.N., Arseniev A.S. // Eur. J. Biochem. 2003. V. 270. P. 2038-2046.



c78089d0

Отзывы (через Facebook):

Оставить отзыв с помощью аккаунта FaceBook:

ОСОБЕННОСТИ ВОССТАНОВЛЕНИЯ ПОРШНЕЙ ИЗ СПЛАВОВ АЛЮМИНИЯ АВТОТРАКТОРНОЙ ТЕХНИКИ

В статье рассмотрен прцесс химического никелирования деталей машин и оборудования как эффетивный и экономически выгодный способ получения стойких покрытий. Предлагается внедрить этот процесс в технологию восстановления деталей автотракторной техники из алюминиевых сплавов. ...

18 01 2020 13:29:58

РАСПРОСТРАНЕННОСТЬ ОНМК СРЕДИ ЛИЦ МОЛОДОГО ВОЗРАСТА

Статья в формате PDF 261 KB...

08 01 2020 10:49:41

ИНЖЕНЕРНАЯ ГРАФИКА (электронное учебное пособие)

Статья в формате PDF 103 KB...

07 01 2020 19:12:11

ПОДЖЕЛУДОЧНАЯ ЖЕЛЕЗА У БЕЛОЙ КРЫСЫ

Статья в формате PDF 297 KB...

03 01 2020 15:14:33

СОСТОЯНИЕ НЕКОТОРЫХ ПОКАЗАТЕЛЕЙ ОКИСЛИТЕЛЬНОВОССТАНОВИТЕЛЬНЫХ ПРОЦЕССОВ У БОЛЬНЫХ ОСТРЫМ ХОЛЕЦИСТИТОМ И ИХ КОРРЕКЦИЯ

Под наблюдением автора было 262 больных острым холециститом. Обсуждаются вопросы адаптации больных к условиям операционного и послеоперационного периодов, которая зависит от окислительно-восстановительных процессов, обусловленных функционированием ферментативных систем, гипоксии тканей, снижения приспособительных реакций, особенно выраженных у лиц старше 50 лет. В контрольной группе (178) больных уже при поступлении в клинику намечалась тенденция к снижению Р О2 в подкожно-жировой основе, а в момент операции оно было выраженным и устойчивым, которое держалось в течение 6 дней. Так же на всем протяжении послеоперационного периода у больных наблюдалось уменьшение кислородной емкости крови, концентрации SH-групп в плазме крови, только к моменту выписки эти показатели приближались к норме. Концентрация молочной и пировиноградной кислот крови тоже было повышенным. В исследуемой группе (84) больных, которые получали в комплексном лечении во время операции и послеоперационном периоде ганглиоблокаторы и гепарин, напряжение кислорода во время операции повышалось на 68%, повышение сохранялось 2-3 дня, а к концу 5 дня р О2 было в пределах нормы. Намечалась тенденция увеличения кислородной емкости крови и SH-групп в плазме. Не смотря на то, что при поступлении лактат и пируват были выше контроля, уже в первый день после операции эти показатели были ниже контрольных. Автор делает вывод о том, что применение в комплексном лечении ганглиоблокаторов и гепарина, позволяло улучшать кислородный баланс крови и ткани и, улучшать окислительновосстановительные процессы, адаптацию организма больного к стрессовым условиям, что способствовало снижению процента послеоперационных осложнений и летальности. ...

29 12 2019 5:46:48

ДИПЛОМНОЕ ПРОЕКТИРОВАНИЕ (учебное пособие)

Статья в формате PDF 97 KB...

26 12 2019 7:24:22

МОТИВАЦИЯ ТРУДА В ПОТРЕБИТЕЛЬСКОЙ КООПЕРАЦИИ

Статья в формате PDF 214 KB...

08 12 2019 0:37:25

ЗЕЛЕНЫЕ ИНДИКАТОРЫ СОСТОЯНИЯ ОКРУЖАЮЩЕЙ СРЕДЫ

Статья в формате PDF 302 KB...

01 12 2019 8:42:54

АНДРЕЕВА МАРИЯ АНДРЕЕВНА

Статья в формате PDF 84 KB...

26 11 2019 1:13:42

ПАНКРЕАТИТ КАК ОСЛОЖНЕНИЕ ПАПИЛЛОТОМИЙ – ПРИЧИНЫ ВОЗНИКНОВЕНИЯ, МЕРЫ ПРОФИЛАКТИКИ

На материале 769 клинических наблюдений проведен анализ причин возникновения острого панкреатита после эндоскопической папиллотомии. Установлено, что основой их развития является прямое повреждение главного протока поджелудочной железы. Разработаны способы профилактики постманипуляционных панкреатитов. ...

25 11 2019 1:52:20

Гиперболическая модель задачи о фазовом переходе

Статья в формате PDF 117 KB...

24 11 2019 16:12:43

АВЕРЬЯНОВ ПЕТР ФЕДОРОВИЧ

Статья в формате PDF 82 KB...

08 11 2019 16:32:40

PROBLEMS OF BIOCHEMICAL INDICATION OF STATUS OF FISHES OF NORTH BASIN

Статья в формате PDF 127 KB...

04 11 2019 23:12:24

УПРАВЛЕНИЕ КАЧЕСТВОМ. КУРС В СХЕМАХ (учебное пособие)

Статья в формате PDF 114 KB...

24 10 2019 13:25:22

Особенности гаметогенеза рыб на примере карповых

Статья в формате PDF 124 KB...

20 10 2019 11:26:19

ИЛЬМУШКИН ГРИГОРИЙ МАКСИМОВИЧ

Статья в формате PDF 102 KB...

19 10 2019 1:58:26

АЛГОРИТМ РАСЧЕТА МОДИФИЦИРОВАННОЙ ГЕРТ-СЕТИ

Статья в формате PDF 130 KB...

06 10 2019 6:16:51

НЕКОТОРЫЕ СВЕДЕНИЯ О ПРОДУКТАХ ИЗ БОБОВ СОИ

Статья в формате PDF 130 KB...

03 10 2019 23:51:53

РЕШЕНИЕ IV СЕССИИ РАЕ

Статья в формате PDF 65 KB...

01 10 2019 0:49:11

СИСТЕМНАЯ МЕДИЦИНА В САНАТОРНО-КУРОРТНОЙ ПРАКТИКЕ

Статья в формате PDF 144 KB...

30 09 2019 13:34:20

ПОЦЕЛУЕВА ЛЮДМИЛА АЛЕКСАНДРОВНА

Статья в формате PDF 109 KB...

25 09 2019 5:20:46

ПРОБЛЕМА ФОРМИРОВАНИЯ КОМПЕТЕНТНОСТЕЙ В УЧЕБНО-ВОСПИТАТЕЛЬНОМ ПРОЦЕССЕ НАЧАЛЬНОЙ ШКОЛЫ

Стратегия социально-экономического развития Р Ф поставило на государственном уровне вопрос о достижении нового качества общего образования – готовности и способности учащихся к непрерывному образованию. В настоящее время в соответствии с основными тенденциями развития современного образования меняются целевые, процессуальные и результативные компоненты учебно-воспитательного процесса и прежде всего в начальной школе. ...

24 09 2019 3:36:40

СУБЪЕКТИВНЫЕ БАРЬЕРЫ ОБЩЕНИЯ У ПОДРОСТКОВ

Статья в формате PDF 114 KB...

18 09 2019 5:31:15

СРАВНИТЕЛЬНАЯ ХАРАКТЕРИСТИКА ИЗМЕНЕНИЙ ДЕФИНИТИВНОЙ СТРУКТУРЫ СЕЛЕЗЕНКИ НА ФОНЕ ХРОНИЧЕСКОЙ АЛКОГОЛЬНОЙ ИНТОКСИКАЦИИ В ЭКСПЕРИМЕНТЕ И У ЧЕЛОВЕКА

Статья посвящена актуальной проблеме – влиянию хронической алкогольной интоксикации на изменение морфоструктуры селезенки. Дана сравнительная гистологическая характеристика соединительно-тканного каркаса и белой пульпы селезенки у животных в эксперименте и у человека. Представлены дегенеративные изменения гистологической структуры селезенки. ...

15 09 2019 20:13:39

МИРОВОЙ ФИНАНСОВЫЙ КРИЗИС 2008–2009 ГГ.

Статья в формате PDF 294 KB...

12 09 2019 5:34:10

УНИВЕРСАЛЬНЫЙ БЛОК УПРАВЛЕНИЯ ЭНЕРГОНАГРУЗКАМИ

Статья в формате PDF 122 KB...

11 09 2019 23:24:25

ВИДЫ ПАРАДЕЙСТВИЙ В ЯЗЫКЕ И ИССЛЕДОВАНИЕ НЕВЕРБАЛЬНЫХ ЭЛЕМЕНТОВ В ЯЗЫКОЗНАНИИ

В статье говорится о видах парадействий в языке и исследованиях невербальных элементов в языкознании. ...

03 09 2019 5:25:29

ХОРУНЖИН ВЛАДИМИР СТЕПАНОВИЧ

Статья в формате PDF 174 KB...

30 08 2019 14:13:59

СОБСТВЕННОСТЬ И СВОБОДА

Статья в формате PDF 112 KB...

28 08 2019 23:52:46

Еще:
Обзоры -1 :: Обзоры -2 :: Обзоры -3 :: Обзоры -4 :: Обзоры -5 :: Обзоры -6 :: Обзоры -7 :: Обзоры -8 :: Обзоры -9 :: Обзоры -10 :: Обзоры -11 ::

Последовательность подготовки научной работы может быть такой:

Выбор темы. Это важный этап. Во-первых, тема должна быть интересна не только вам, но и большинству слушателей, которым вы будете её докладывать, чтобы вы видели заинтересованность в их глазах, а не откровенную скуку.

Выбор целей и задач своей научной работы. То есть, нужно сузить тему. Например, тема: «Грудное вскармливание», сужение темы: «Грудное вскармливание среди студенток нашего ВУЗа». И если общая тема мало кому интересна, то суженная до рамок собственного института или университета, она становится интересной практически для всех слушателей. Целью может стать: «Содействие оптимальным условиям вскармливания грудью детей студентов нашего ВУЗа», а задачей — доказать, что специальные условия, созданные для кормящих студенток, не помешают их успеваемости, но уменьшат количество пропусков, академических отпусков и способствуют выращиванию здоровых детей — нашего будущего. Понятно, что эта тема подходит для студентов медицинских и педагогических ВУЗов, но и в других учебных учреждениях можно найти темы, интересные всем.

Разработать методы исследования и сбора информации. В случае с естественным вскармливанием, скорее всего, это будет анкетирование студенток, имеющих детей.

Систематизировать материал и подготовить презентацию.

Подготовиться к выступлению.

Выступить и получить: награду, удовольствие и опыт, чтобы в следующем году выступить ещё лучше и сорвать шквал аплодисментов, стать узнаваемым, а значит — более конкурентоспособным!