IT-Reviews    

ВЗАИМОДЕЙСТВИЕ АНАЛОГА ПЕПТИДА СЛИЯНИЯ ИЗ ГЕМАГГЛЮТИНИНА ВИРУСА ГРИППА С ФОСФОЛИПИДНЫМИ ЛИПОСОМАМИ: ИЗУЧЕНИЕ МЕТОДОМ 31Р-ЯМР

c78089d0 Источник:
Лесовой Д.М. Жмак М.Н. Люкманова Е.Н. Дубовский П.В. Статья в формате PDF 112 KB

Пептиды слияния - фрагменты вирусных белков, состоящие из 20-25 аминокислот, способные вызывать слияние липидных и биологических мембран [1]. При изучении этих процессов удобно работать с водорастворимыми аналогами. Нами сконструирован аналог F31, состоящий из 31-го аминокислотного остатка: glfgaiagfieggwtgmidgwygygggkkkk.

С-концевой фрагмент GCGKKK обеспечивает водорастворимостиь пептида, а N-концевая часть (остатки 1-24) соответствует пептиду слияния из гемагглютинина (штамм A/PR/8/34). В пептиде имеется только один остаток глутаминовой кислоты (Glu11). Цель данной работы - изучить влияние пептида F31 на фосфолипидные липосомы при различных состояниях ионизации этого остатка. С учётом данных по величинам рКа остатков Glu в пептидах слияния, находящихся в мембранном окружении, есть основания считать, что при изменении рН от 7 до 4 с большой долей вероятности происходит протонирование боковой карбоксильной группы этого остатка. Поэтому нами взяты эти значения рН как такие, при которых остаток полностью заряжен (рН 7) и нейтрален (рН 4), соответственно. Фосфолипидные липосомы формировались из анионного фосфолипида диолеоилфосфатидилглицерина (ДОФГ). Т.к. заряд пептида в целом положителен при обоих значениях рН (4 и 7), это обеспечивает эффективное связывание с пловерхностью липосом за счёт электростатического притяжения. Следовательно, изменение характера вляиния пептида на липосомы при изменении рн от 7 до 4 будет означать изменение характера гидрофобного взаимодействия пептида с липосомами, вероятно, за счёт изменения глубины проникновения пептида в фосфолипидный бислой и/или характера ассоции пептидов на липосомах.

Наиболее удобным методом для исследования взаимодействий липид/пептид является метод 31P-ЯМР спектроскопии широких линий. Данный метод позволяет работать с бислойными мультиламеллярными липосомами, которые более адекватно моделирует биологическую мембрану. Показано, что форма линии 31P-ЯМР спектров мембран чувствительна к анизотропным движениям молекул фосфолипидов[2, 3], что позволяет следить за изменениями состояния модельной мембраны под воздействием пептида.

Для изучения рН-зависимости взаимодействия были проведены серии экспериментов при рН 4 и 7. Проанализировав полученные 31Р-ЯМР спектры с помощью разработанной нами программы P-FIT [4], были получены зависимости параметров, характеризующих состояние бислоя в зависимости от соотношения липид/пептид.

При рН 4 наблюдается значительное влияние пептида на состояние бислоя. Так, при последовательном добавлении пептида, начиная с соотношения липид/пептид 40:1 происходит формирование второй анизотропной составляющей. Данная составляющая характеризуется уменьшенным значением анизотропии химического сдвига а также уменьшенным значением степени деформации липосом магнитным полем спектрометра, что связано с уменьшением эластичности мембраны. При уменьшением соотношения липид/пептид от 40:1 до 15:1 происходит рост вклада этой составляющей от ~15% до ~50%. Также стоит отметить что начиная с соотношения липид/пептид 30:1 становится значительным вклад от изотропной составляющей, которая соответствует разрушенным липосомам. Величина этой составляющей растёт пропорционально количеству добавленного пептида и достигает значений 3-4%.

При рН 7 картина взаимодействия существенно иная: Во всём изученном диапазоне значений липид/пептид(от 50 до 15) не наблюдалось формирование дополнительных состояний модельного липидного бислоя. В то время как наблюдалось небольшое изменение параметров эластичности бислоя.

Таким образом, анализ влияния пептида на бислои ДОФГ при выбранных значениях рН подтверждает предположение о существенной роли ионогенного сотояния состояния остатка Glu11 во взаимодействии пептида слияния этого типа с липидным бислоем.

Благодарность:

Выражаем признательность РФФИ за финансовую поддержку, грант № 02-48882.

СПИСОК ЛИТЕРАТУРЫ

  1. Dubovskii, P.V., Li, H., Takahashi, S., Arseniev, A.S., and Akasaka, K.Protein Sci., 2000 V. 9, P. 786-798.
  2. Seelig J. Biochim. Biophys. Acta. 1978. V. 515. P. 105-140.
  3. Brumm T., Mops A., Dolainsky C., Bruckner S., Bayerl T.M. Biophys. J. 1992. V. 61. P. 1018-1024.
  4. Dubovskii P.V., Lesovoy D.M., Dubinnyi M.A., Utkin Y.N., Arseniev A.S. // Eur. J. Biochem. 2003. V. 270. P. 2038-2046.



Отзывы (через Facebook):

Оставить отзыв с помощью аккаунта FaceBook:

ИССЛЕДОВАНИЕ МЕЖМОЛЕКУЛЯРНЫХ ВЗАИМОДЕЙСТВИЙ В ПРОТЕИН-ПОЛИСАХАРИДНЫХ ГЕЛЯХ МЕТОДОМ Н+ЯМР-РЕЛАКСАЦИИ

Методом Н+ Я М Р-релаксации изучены межмолекулярные взаимодействия в гелях крахмала в молочной среде. Установлены зависимости скоростей поперечной и продольной релаксаций протонов от концентрации крахмала для водных и молочных систем. Казеин синергетически влияет на гелеобразующую способность крахмала, который иммобилизует воду в молочной среде более активно, чем в водной. На основании исследований температурной зависимости поперечной релаксации доказано образование комплексного геля, представляющего собой сетку из спиральных молекул крахмала, в ячейки которой включены мицеллы и субмицеллы казеина. ...

14 01 2021 17:16:48

ТЕРМОДИНАМИЧЕСКИЕ КОНСТАНТЫ ДИССОЦИАЦИИ ПРОТОНИРОВАННЫХ ОСНОВАНИЙ

Разработана методика определения констант диссоциации протонированных трехкислотных оснований, отличающаяся новым подходом к оценке и учету концентраций всех равновесных частиц, для расчета ионной силы раствора. ...

11 01 2021 0:50:18

ПОДТВЕРЖДЕНИЕ ЭФФЕКТИВНОСТИ ПРИМЕНЕНИЯ ПРЕПАРАТА «КОРТЕКСИН» У ПОДРОСТКОВ МЕТОДОМ ИК-СПЕКТРОМЕТРИИ

Малоизученным направлением в диагностике психосоматических заболеваний является исследование физико-химических характеристик крови. Методы, применяемые в диагностике и контроле лечения психосоматических заболеваний в целом, и задержке психического развития в частности ( З П Р), являются достаточно субъективными. Во многом это обусловлено отсутствием однозначных лабораторно-диагностических методов, позволяющих осуществлять диагностику на ранних этапах заболевания. Целью нашего исследования явилось изучение особенностей И К – спектра сыворотки крови детей подросткового возраста. В качестве субстрата для исследования использовали сыворотку крови больных детей, которую затем подвергали И К-спектроскопии с регистрацией спектров поглощения в области 3500-963 см-1. Исследована сыворотка крови 30 детей с диагнозом З П Р и 30 здоровых, сопоставимых по возрасту и полу. Было проведено сравнение И К-спектра сыворотки крови больных с  З П Р и здоровых доноров. Достоверно выявлена разница показателей инфракрасной спектрометрии в норме и патологии, а так же проверена эффективность применяемой терапии. Таким образом, с помощью И К-спектрометрии установлены особенности спектров сыворотки крови детей подросткового возраста и выявлены отличия в спектре у детей с  З П Р и динамические изменения в процессе лечения, что может использоваться для диагностики данной патологии, а так же для контроля за эффективностью проводимого лечения. ...

09 01 2021 12:48:18

ИММУНИТЕТ И РАЗЛИЧНЫЕ СТАДИИ СТРЕССОРНОГО ВОЗДЕЙСТВИЯ

Изучение иммунитета при стрессе является правомерным в оценке адаптивных систем организма и его резервных возможностей. На основании анализа функциональных возможностей иммунитета можно воздействовать на адаптивные системы и прогнозировать течение стресс-реакции. ...

06 01 2021 13:39:11

ПРИМЕНЕНИЕ МЕТОДОВ АППРОКСИМАЦИИ ДАННЫХ

Статья в формате PDF 253 KB...

29 12 2020 20:26:49

УНИВЕРСАЛЬНЫЙ БЛОК УПРАВЛЕНИЯ ЭНЕРГОНАГРУЗКАМИ

Статья в формате PDF 122 KB...

27 12 2020 8:25:40

ОСОБЕННОСТИ ГРИППА ЗА 2011-2012 ГГ. В Г. НАЛЬЧИКЕ

Статья в формате PDF 242 KB...

19 12 2020 20:39:30

ОЦЕНКА ПЕРСПЕКТИВ РАЗВИТИЯ ЛЕСНЫХ КОМПЛЕКСОВ В РЕГИОНАХ С СИЛЬНЫМ АНТРОПОГЕННЫМ ВОЗДЕЙСТВИЕМ

Все более актуальной в настоящее время становится проблема прогнозирования динамики развития региональных лесных комплексов. В качестве одного из этапов исследований по этой теме автором в содружестве с Гринпис России был выполнен описанный в статье проект. В рамках проекта разработана экономико-математическая модель. Последующая реализация модели на компьютере с использованием реальных данных показала ее эффективность для решения задач прогнозирования лесной отрасли. В качестве региона для апробации модели был выбран Санкт- Петербург и область, где влияние человека на окружающую среду в последнее время существенно возросло. Проведенная на основе статистических тестов верификация модели показала ее соответствие реальности. С целью апробации модели были сформированы два сценария с различными значениями показателей внешнего воздействия на региональную систему лесного комплекса. В результате, после имитации были получены основные параметры регионального лесного комплекса, соответствующие двум сценариям. ...

07 12 2020 14:38:41

ДИАГНОСТИКА ЖЕЛЕЗОДЕФИЦИТНОЙ АНЕМИИ У ДЕТЕЙ

Статья в формате PDF 302 KB...

04 12 2020 12:40:56

ЩИТОВИДНАЯ ЖЕЛЕЗА: ПОКАЗАТЕЛЬ ПЛОЩАДИ КОНТАКТА ЭПИТЕЛИЙ-СТРОМА

Разработан новый морфометрический показатель площади контакта эпителия и стромы. Показатель использовался автором при многолетних исследованиях морфофункционального состояния щитовидной железы у женщин и в эксперименте. ...

28 11 2020 5:23:42

ЭЛЕМЕНТЫ И ПУТИ РЕАЛИЗАЦИИ КАДРОВОЙ ПОЛИТИКИ БАНКА

Статья в формате PDF 124 KB...

26 11 2020 15:19:21

НОВЫЕ АСПЕКТЫ ПОДБОРА ИММУНОТРОПНЫХ СРЕДСТВ В ТЕРАПИИ УРОГЕНИТАЛЬНОГО ХЛАМИДИОЗА

В исследовании изучена возможность оптимизации терапии больных урогенитальным хламидиозом, на основе внедрения новой методики цитокининдуцированного определения чувствительности к лекарственным средствам. Под наблюдением находилось 240 больных урогенитальным хламидиозом обоего пола, в возрасте от 18 до 65 лет. В результате применения цитокининдуцированной методики определения чувствительности к лекарственным средствам, удалось значительным образом повысить эффективность терапии больных хламидиозом. ...

21 11 2020 1:46:37

ПРОПАГАНДА ПРАВОВЫХ ЗНАНИЙ В ВУЗЕ, КОЛЛЕДЖЕ, ШКОЛЕ

Статья в формате PDF 125 KB...

15 11 2020 5:49:53

КЛИМАТ И РЕКРЕАЦИЯ

Статья в формате PDF 253 KB...

13 11 2020 22:15:40

МОДЕЛИРОВАНИЕ ЦЕЛОСТНОГО ОБРАЗОВАТЕЛЬНОГО ПРОСТРАНСТВА

В настоящее время важно пройти сложнейший этап перехода к новому типу социально-экономического развития быстро, компетентно, опираясь на собственные творческие возможности. Именно этим целям служит разработанная нами модель педагогических основ формирования целостного образовательного пространства, основу которого составляет внедрение непрерывного образования в интегрированном профессиональном учебном заведении. Моделирование целостного образовательного пространства осуществлялось нами через уточнение таких понятий, как «интеграция», «межпредметные связи», «взаимосвязь», интегративно-педагогические закономерности, интегративная деятельность, через изучение опыта зарубежных исследователей, решающих проблемы педагогической интеграции. ...

12 11 2020 20:21:45

ПЕРСОНАЛ БАНКА КАК ВАЖНЕЙШИЙ ЕГО КАПИТАЛ

Статья в формате PDF 118 KB...

04 11 2020 11:53:50

О ВЛИЯНИИ ГЕОМАГНИТНОГО ПОЛЯ (ГМП) НА БИОТУ

Статья в формате PDF 85 KB...

29 10 2020 4:33:24

ЕСТЕСТВЕННОНАУЧНЫЕ ОСНОВАНИЯ СТЕРЕОХРОНОДИНАМИКИ

Статья в формате PDF 161 KB...

25 10 2020 3:55:39

ИСПОЛЬЗОВАНИЕ БИОЛОГИЧЕСКИХ ТЕСТОВ И ЗАДАЧ ДЛЯ ВЫЯВЛЕНИЯ УЧАЩИХСЯ С ПОВЫШЕННЫМ УРОВНЕМ ИНТЕЛЛЕКТА

В работе приводятся сведения относительно возможности применения тестовых заданий и биологических задач для исследования личностных особенностей учащихся и выявления одаренных детей. Показано, что использование этого подхода может способствовать повышению эффективности выявления школьников с повышенным уровнем интеллекта. ...

24 10 2020 12:24:12

ЭКОНОМИЧЕСКИЕ ВОПРОСЫ РЕМОНТА БЫТОВОЙ ТЕХНИКИ

В статье показано, что ремонт бытовой техники в зависимости от сложности и условий эксплуатации подразделяется на ремонт непосредственно на дому у заказчика, ремонт в мастерской. Ремонт на дому у заказчика связан с выполнением мелкого и среднего ремонта, т.е. когда ремонт технически возможен и экономически целесообразен. Ремонт в мастерской выполняется тогда, когда невозможно его выполнить в домашних условиях. Кроме того , ремонт бывает в гарантийный период и в послегарантийный периоды эксплуатации. Во всех случаях оплата за ремонт осуществляется по своим правилам, ...

17 10 2020 2:55:53

ЭХОГРАФИЧЕСКИЕ МАРКЕРЫ ВНУТРИУТРОБНОЙ ИНФЕКЦИИ

Одной из важнейших проблем современной перинатологии является прогрессирующий рост инфекционной патологии у плода и новорожденного. Целью данной работы являлась комплексная ультразвуковая оценка фето-плацентарной системы у беременных с высоким инфекционным индексом для прогнозирования степени тяжести внутриутробного инфицирования у новорожденного. Обследовано 123 беременных в сроке гестации 30-36 недель. В зависимости от тяжести состояния все новорожденные ретроспективно были разделены на 4 группы. В контрольную (1 группа) вошли новорожденные от матерей с неосложненной беременностью, состояние ребенка при рождении удовлетворительное. В основную (1 – 4 группы) вошли новорожденные от матерей с высоким инфекционным индексом, с локальными или генерализованными проявлениями внутриутробной инфекции. В результате проведенного исследования выявлены эхографические маркеры амнионита, плацентита и собственно инфекционного поражения плода, которое наиболее значимо для прогнозирования рождения ребенка с В У И. Патологические показатели биофизической активности, допплерометрия отражают системные нарушения в состоянии плода, его дисстресс. Таким образом, чем больше эхографических маркеров внутриутробного инфицирования встречается у плода, тем более вероятно рождение ребенка с признаками В У И. ...

16 10 2020 11:57:11

ГОРНЫЕ ПОРОДЫ: АЛГОРИТМЫ ОПРЕДЕЛЕНИЯ

Статья в формате PDF 157 KB...

04 10 2020 21:21:34

ДИНАМИКА СОДЕРЖАНИЯ ДНК В ЯДРАХ КЛЕТОК СЛИЗИСТОЙ ОБОЛОЧКИ ЖЕЛУДКА ОТ ГИСТОЛОГИЧЕСКОЙ НОРМЫ ДО НЕОПЛАСТИЧЕСКИХ ИЗМЕНЕНИЙ

В статье авторы показали изменение плоидности и площади ядер слизистой оболочки желудка при фоновых, предраковых заболеваниях и раке желудка различного гистологического строения с помощью компьютерного анализатора изображения. При дисплазии тяжелой степени площадь и плоидность ядра составили 213,7±3,42 мкм² и 10,2±0,2с соответственно. При высокодифференцированной аденокарциноме эти показатели достигают 375,0±17,0 мкм² и 16,2±2,7с. Авторы предположили, что полученные данные могут быть использованы для более объективной оценки патологических процессов в слизистой желудка и дифференциальнодиагностических вопросов между дисплазиями и раком желудка. ...

03 10 2020 14:26:58

СТОЛЯРОВ ВЛАДИМИР АЛЕКСЕЕВИЧ

Статья в формате PDF 139 KB...

25 09 2020 20:48:11

ПОЧВЕННЫЕ МИКРООРГАНИЗМЫ В ЗОНЕ УРАНОВЫХ МЕСТОРОЖДЕНИЙ ЭЛЬКОНСКОГО ГОРСТА

Установлены специфические особенности микробного населения почв мерзлотных горно-таежных техногенных ландшафтов Эльконского ураново-рудного района на территории Южной Якутии. Такие как высокая численность эколого-трофических групп микроорганизмов (2,0·103–7,6·107 кл/г), сопоставимая с плотностью микробов в лугово-степных почвах Центральной Якутии и особый характер распределения их по профилю почв в зависимости от содержания в них урана. В почве радиоактивно-загрязненного разреза с уменьшением содержания урана до 161 мг/кг наблюдается увеличение численности всех исследованных групп микроорганизмов. В остальных образцах данного разреза с увеличением содержания урана в почве наблюдается исчезновение или спад численности микроорганизмов на 1–2 порядка. В отличие от загрязненного разреза в почве нативного ландшафта численность микроорганизмов остается достаточно высокой по всему почвенному профилю. ...

14 09 2020 17:31:33

АНАТОМИЯ ПОЯСНИЧНЫХ СТВОЛОВ БЕЛОЙ КРЫСЫ

Статья в формате PDF 115 KB...

10 09 2020 16:39:53

АКТУАЛЬНОСТЬ ЭКОЛОГИЧЕСКОГО ОБРАЗОВАНИЯ

Статья в формате PDF 129 KB...

08 09 2020 15:43:19

СРАВНИТЕЛЬНЫЙ АНАЛИЗ ФИЗИЧЕСКОЙ НАГРУЗКИ РАЗЛИЧНОЙ НАПРАВЛЕННОСТИ НА АНТРОПОМЕТРИЧЕСКИЕ ПОКАЗАТЕЛИ У ЖЕНЩИН РАЗНЫХ ВОЗРАСТНЫХ ГРУПП С ИЗБЫТОЧНОЙ МАССОЙ ТЕЛА

Проведен анализ эффективности различных типов фитнес-программ в коррекции избыточной массы тела женщин юношеского и зрелого возраста. Применяемые физические нагрузки отличались характером нагрузки и наличию/отсутствию компонента коррекции питания. Исследовали антропометрические показатели, И М Т, определяли содержание жировой массы в организме методом калипометрии в динамике 6-месячного тренировочного цикла. Проводили промежуточные исследования: в середине, через 3 месяца от начала тренировочного цикла. В исследовании приняли участие 93 практически здоровые женщины с избыточной массой тела, не имеющие эндокринных заболеваний и противопоказаний к занятиям физической культурой. Выделены группы в зависимости от типа программы (I, II), а также подгруппы (Ia, IIa) в зависимости от возраста: 18–21 год (I и II, n = 17 и n = 17, соответственно) и 36–45 лет (Ia, IIa, n = 30 и n = 29, соответственно). Показана динамика и статистическая значимость различий в группах, проведен сравнительный анализ между группами. Выявлена более высокая физиологическая эффективность программы I, базирующейся на смешанном характере тренировки, многовариантной схеме упражнений с мониторированием и коррекцией характера питания. ...

06 09 2020 15:12:14

ЯКУТСКАЯ ПОРОДА ЛОШАДЕЙ В ДРУГИХ РЕГИОНАХ РОССИИ

Статья в формате PDF 276 KB...

01 09 2020 21:23:57

ПСИХОСОМАТИЧЕСКИЙ ПОДХОД В ГЕРОНТОПСИХИАТРИИ

Статья в формате PDF 95 KB...

31 08 2020 8:46:31

ЭКОНОМЕТРИЧЕСКОЕ МОДЕЛИРОВАНИЕ

Статья в формате PDF 345 KB...

21 08 2020 12:43:17

РЕГИОНАЛЬНАЯ БАНКОВСКАЯ СИСТЕМА И ЭКОНОМИКА

Статья в формате PDF 102 KB...

20 08 2020 7:38:50

Еще:
Обзоры -1 :: Обзоры -2 :: Обзоры -3 :: Обзоры -4 :: Обзоры -5 :: Обзоры -6 :: Обзоры -7 :: Обзоры -8 :: Обзоры -9 :: Обзоры -10 :: Обзоры -11 ::

Последовательность подготовки научной работы может быть такой:

Выбор темы. Это важный этап. Во-первых, тема должна быть интересна не только вам, но и большинству слушателей, которым вы будете её докладывать, чтобы вы видели заинтересованность в их глазах, а не откровенную скуку.

Выбор целей и задач своей научной работы. То есть, нужно сузить тему. Например, тема: «Грудное вскармливание», сужение темы: «Грудное вскармливание среди студенток нашего ВУЗа». И если общая тема мало кому интересна, то суженная до рамок собственного института или университета, она становится интересной практически для всех слушателей. Целью может стать: «Содействие оптимальным условиям вскармливания грудью детей студентов нашего ВУЗа», а задачей — доказать, что специальные условия, созданные для кормящих студенток, не помешают их успеваемости, но уменьшат количество пропусков, академических отпусков и способствуют выращиванию здоровых детей — нашего будущего. Понятно, что эта тема подходит для студентов медицинских и педагогических ВУЗов, но и в других учебных учреждениях можно найти темы, интересные всем.

Разработать методы исследования и сбора информации. В случае с естественным вскармливанием, скорее всего, это будет анкетирование студенток, имеющих детей.

Систематизировать материал и подготовить презентацию.

Подготовиться к выступлению.

Выступить и получить: награду, удовольствие и опыт, чтобы в следующем году выступить ещё лучше и сорвать шквал аплодисментов, стать узнаваемым, а значит — более конкурентоспособным!