IT-Reviews    

ВЗАИМОДЕЙСТВИЕ АНАЛОГА ПЕПТИДА СЛИЯНИЯ ИЗ ГЕМАГГЛЮТИНИНА ВИРУСА ГРИППА С ФОСФОЛИПИДНЫМИ ЛИПОСОМАМИ: ИЗУЧЕНИЕ МЕТОДОМ 31Р-ЯМР

c78089d0 Источник:
Лесовой Д.М. Жмак М.Н. Люкманова Е.Н. Дубовский П.В. Статья в формате PDF 112 KB

Пептиды слияния - фрагменты вирусных белков, состоящие из 20-25 аминокислот, способные вызывать слияние липидных и биологических мембран [1]. При изучении этих процессов удобно работать с водорастворимыми аналогами. Нами сконструирован аналог F31, состоящий из 31-го аминокислотного остатка: glfgaiagfieggwtgmidgwygygggkkkk.

С-концевой фрагмент GCGKKK обеспечивает водорастворимостиь пептида, а N-концевая часть (остатки 1-24) соответствует пептиду слияния из гемагглютинина (штамм A/PR/8/34). В пептиде имеется только один остаток глутаминовой кислоты (Glu11). Цель данной работы - изучить влияние пептида F31 на фосфолипидные липосомы при различных состояниях ионизации этого остатка. С учётом данных по величинам рКа остатков Glu в пептидах слияния, находящихся в мембранном окружении, есть основания считать, что при изменении рН от 7 до 4 с большой долей вероятности происходит протонирование боковой карбоксильной группы этого остатка. Поэтому нами взяты эти значения рН как такие, при которых остаток полностью заряжен (рН 7) и нейтрален (рН 4), соответственно. Фосфолипидные липосомы формировались из анионного фосфолипида диолеоилфосфатидилглицерина (ДОФГ). Т.к. заряд пептида в целом положителен при обоих значениях рН (4 и 7), это обеспечивает эффективное связывание с пловерхностью липосом за счёт электростатического притяжения. Следовательно, изменение характера вляиния пептида на липосомы при изменении рн от 7 до 4 будет означать изменение характера гидрофобного взаимодействия пептида с липосомами, вероятно, за счёт изменения глубины проникновения пептида в фосфолипидный бислой и/или характера ассоции пептидов на липосомах.

Наиболее удобным методом для исследования взаимодействий липид/пептид является метод 31P-ЯМР спектроскопии широких линий. Данный метод позволяет работать с бислойными мультиламеллярными липосомами, которые более адекватно моделирует биологическую мембрану. Показано, что форма линии 31P-ЯМР спектров мембран чувствительна к анизотропным движениям молекул фосфолипидов[2, 3], что позволяет следить за изменениями состояния модельной мембраны под воздействием пептида.

Для изучения рН-зависимости взаимодействия были проведены серии экспериментов при рН 4 и 7. Проанализировав полученные 31Р-ЯМР спектры с помощью разработанной нами программы P-FIT [4], были получены зависимости параметров, характеризующих состояние бислоя в зависимости от соотношения липид/пептид.

При рН 4 наблюдается значительное влияние пептида на состояние бислоя. Так, при последовательном добавлении пептида, начиная с соотношения липид/пептид 40:1 происходит формирование второй анизотропной составляющей. Данная составляющая характеризуется уменьшенным значением анизотропии химического сдвига а также уменьшенным значением степени деформации липосом магнитным полем спектрометра, что связано с уменьшением эластичности мембраны. При уменьшением соотношения липид/пептид от 40:1 до 15:1 происходит рост вклада этой составляющей от ~15% до ~50%. Также стоит отметить что начиная с соотношения липид/пептид 30:1 становится значительным вклад от изотропной составляющей, которая соответствует разрушенным липосомам. Величина этой составляющей растёт пропорционально количеству добавленного пептида и достигает значений 3-4%.

При рН 7 картина взаимодействия существенно иная: Во всём изученном диапазоне значений липид/пептид(от 50 до 15) не наблюдалось формирование дополнительных состояний модельного липидного бислоя. В то время как наблюдалось небольшое изменение параметров эластичности бислоя.

Таким образом, анализ влияния пептида на бислои ДОФГ при выбранных значениях рН подтверждает предположение о существенной роли ионогенного сотояния состояния остатка Glu11 во взаимодействии пептида слияния этого типа с липидным бислоем.

Благодарность:

Выражаем признательность РФФИ за финансовую поддержку, грант № 02-48882.

СПИСОК ЛИТЕРАТУРЫ

  1. Dubovskii, P.V., Li, H., Takahashi, S., Arseniev, A.S., and Akasaka, K.Protein Sci., 2000 V. 9, P. 786-798.
  2. Seelig J. Biochim. Biophys. Acta. 1978. V. 515. P. 105-140.
  3. Brumm T., Mops A., Dolainsky C., Bruckner S., Bayerl T.M. Biophys. J. 1992. V. 61. P. 1018-1024.
  4. Dubovskii P.V., Lesovoy D.M., Dubinnyi M.A., Utkin Y.N., Arseniev A.S. // Eur. J. Biochem. 2003. V. 270. P. 2038-2046.



Отзывы (через Facebook):

Оставить отзыв с помощью аккаунта FaceBook:

СПОСОБ ЛЕЧЕНИЯ ГИПЕРТРОФИЧЕСКИХ РУБЦОВ

Статья в формате PDF 111 KB...

17 10 2020 8:13:54

ЭПИДЕМИЧЕСКАЯ БЕЗОПАСНОСТЬ ТУРИСТА

Статья в формате PDF 116 KB...

15 10 2020 2:24:57

ПЕРВОЕ НАЧАЛО ТЕРМОЛЕВИТАЦИИ

Статья в формате PDF 114 KB...

14 10 2020 3:26:52

МОЛЕКУЛЯРНАЯ ПАТОЛОГИЯ АЛЬДЕГИДНАЯ БОЛЕЗНЬ

Статья в формате PDF 119 KB...

13 10 2020 0:45:30

ЛАЗЕРНОЕ ЛЕГИРОВАНИЕ ПОВЕРХНОСТИ ТИТАНА МЕДЬЮ

Статья в формате PDF 111 KB...

04 10 2020 22:45:55

ИСЛЕДОВАНИЕ РАБОТЫ КОТЕЛЬНОГО АГРЕГАТА ТП-13/В, РАБОТАЮЩЕГО НА ПРИРОДНО-ДОМЕННОЙ СМЕСИ ГАЗОВ

В статье отражен анализ работы котельного агрегата Т П-13/ В, работающего на смеси природного и доменного газов, выявлены основные недостатки его работы. Также предложены мероприятия, позволяющие повысить эффективность котельного агрегата и решить некоторые проблемы, связанные с его работой. Рассмотрена целесообразность внесения предложенных изменений. ...

02 10 2020 3:28:53

АКТИВНЫЕ МЕТОДЫ ОБУЧЕНИЯ

Статья в формате PDF 249 KB...

26 09 2020 20:25:31

ПОДЖЕЛУДОЧНАЯ ЖЕЛЕЗА У БЕЛОЙ КРЫСЫ

Статья в формате PDF 297 KB...

25 09 2020 23:25:43

ОСОБЕННОСТИ ПРОДУКЦИИ ЦИТОКИНОВ ПРИ ВИЧ-ИНФЕКЦИИ

По мере прогрессирования В И Ч-инфекции наблюдается дисбаланс в выработке цитокинов, характеризующийся переключением Тh-1 ответа на Тh-2. Это, в свою очередь, приводит к прогрессированию иммуносупрессии и развитию оппортунистических инфекций. Определено, что IFN-γ, IL-2, IL-4, IL-10 и TGFβ могут обладать разнонаправленным действием в зависимости от локальных условий. Оценка иммунологических параметров может определять прогноз развития заболевания и коpрегировать интенсивность противовирусной терапии. ...

23 09 2020 15:41:20

МЕЛКИЕ МЛЕКОПИТАЮЩИЕ В ТРАНСФОРМИРОВАННЫХ УРБАНИЗАЦИЕЙ ЛЕСНЫХ ЭКОСИСТЕМАХ

По комплексу признаков оценили трансформированные урбанизацией лесные фитоценозы, и населяющие их сообщества мелких млекопитающих в лесопарково-парковой зоне крупного промышленного центра. Выявили, что хотя и наблюдаются общие закономерности в группировке фито- и зооценозов в зависимости от уровня и характера урбаногенного воздействия, но между ними нет полного соответствия. Специфика сообществ мелких млекопитающих определяется не только эдафо-растительными условиями. Ведущим параметром в трансформации сообществ является рекреация и сопровождающие ее факторы. ...

19 09 2020 11:27:48

АГАФОНОВ АЛЕКСАНДР ТИМОФЕЕВИЧ

Статья в формате PDF 151 KB...

16 09 2020 12:10:50

СЕЗОННЫЕ ФАКТОРЫ В РОЖДЕНИИ БОЛЬНЫХ ШИЗОФРЕНИЕЙ

Обсуждается сезонность рождения больных шизофренией. Исследовав 2017 случаев заболевания, авторы отмечают сезонность и гендерные различия в рождении больных шизофренией. Высказывается предположение, что одной из причин сезонных колебаний рождаемости больных, у мужчин, может быть патогенное действие вирусной инфекции на головной мозг плода во втором триместре беременности. ...

12 09 2020 2:25:54

ПРОЦЕССЫ ИЗМЕНЕНИЯ ТЕХНИЧЕСКОГО СОСТОЯНИЯ БЫТОВОЙ ТЕХНИКИ

В статье дано определение техническому состоянию техники, представлены виды технических состояний и процессы изменения технического состояния при эксплуатации. Бытовая техника при эксплуатации может принимать исправное и неисправное состояние, а также работоспособное и неработоспособное состояние. Показана взаимосвязь видов технических состояний в виде графа переходов технических состояний, позволяющий проводить технологию восстановления работоспособности техники. Определен порядок восстановления бытовой техники и сформулирован критерий отказа техники. Рассмотрены признаки восстановления бытовой техники по отношению к восстанавливаемой и невосстанавливаемой техники. Показано, что к невосстанавливаемой технике относится техника, нахоящаяся в предельном состоянии или в результате ресурсного отказа. Рассмотрены признаки предельного состояния для восстанавливаемой и невосстанавливаемой техники. ...

10 09 2020 9:38:18

ОПРЕДЕЛЕНИЕ ТОЛЩИНЫ СМАЗОЧНОЙ ПЛЕНКИ В ЗОНЕ КОНТАКТА АБРАЗИВНЫХ ЗЕРЕН ПРИ ОБРАБОТКЕ ДЕТАЛЕЙ УПЛОТНЕННЫМ АБРАЗИВОМ

В статье приведены результаты исследований величин защитных пленок смазочно-охлаждающей жидкости ( С О Ж) при обработке деталей уплотненным абразивом. При исследовании толщины адсорбционной пленки адсорбцию выражали через молярно – объемные концентрации поверхностно-активных веществ ( П А В) в растворе абразивной суспензии до и после обработки на экспериментальном стенде камерного типа. Полученные значения величин защитных пленок, необходимы для оценки интенсивности обработки поверхности детали выступами микрорельефа абразивного зерна. ...

26 08 2020 23:18:52

ГИСТОТОПОГРАФИЧЕСКОЕ ИЗУЧЕНИЕ СОДЕРЖАНИЯ ПОЛИСАХАРИДОВ И ЛИПИДОВ В ТКАНЯХ TRICHОCEPHALUS TRICHIURUS И TR.MURIS ПРИ ЛЕЧЕНИИ ТРИХОЦЕФАЛЕЗА НЕКОТОРЫМИ АНТИГЕЛЬМИНТИКАМИ

В статье изложены результаты исследования содержания таких биоэнергетически активных компонентов-углеводов и липидов в организме Trichocephalus trichiurus,Tr.muris в норме и после применения принятых терапевтических дозах Вермокса, Медамина и Дифезила. ...

23 08 2020 14:12:13

СРАВНИТЕЛЬНАЯ ОЦЕНКА ВЛИЯНИЯ РАДИАЦИИ, ГИПОТИРЕОЗА И РТУТНОЙ ИНТОКСИКАЦИИ НА АКТИВНОСТЬ ФЕРМЕНТОВ ОБМЕНА ПУРИНОВЫХ НУКЛЕОТИДОВ, АНТИОКСИДАНТНОЙ СИСТЕМЫ И ИММУННЫЙ СТАТУС

В эксперименте в сравнительном плане, изучено влияние радиационного облучения, ртутной интоксикации и гипотиреоза на систему иммунитета, на активность ферментов обмена пуриновых нуклеотидов: 5’-нуклеотидазы, А М Ф-дезаминазы и аденозиндезаминазы, на активность ферментов антиоксидантной системы: супероксиддисмутазы ( С О Д), глутатионпероксидазы ( Г П О), глутатионредуктазы в ткани печени, почек и в сыворотке крови. Установлены значительные сходства в механизме клеточных и метаболических эффектов радиации, гипотиреоза, ртутной интоксикации. Независимо от ткани и воздействующего на организм фактора (радиация, гипотиреоз, ртутная интоксикация) имеет место однотипные изменения активности супероксиддисмутазы, глутатионпероксидазы и глутатионредуктазы, что свидетельствует о том, что указанные воздействия являются стрессорными. Изменения в иммунной системе, обнаруженные при ионизирующем излучении, практически однотипны изменениям иммунитета при гипотиреозе. При ртутной интоксикации в отличие от гипотиреоза и радиации имеет место снижение уровня В-лимфоцитов, что в какой-то мере объясняется особенностями эффектов ртутной интоксикации на систему иммунитета и ферменты метаболизма пуриновых нуклеотидов. В определенной степени эти различия можно объяснить разной степенью становления защитных механизмов и степенью целостности регуляторной функции адрено-тиреоидной системы. ...

22 08 2020 12:29:21

ВЗАИМОДЕЙСТВИЕ 1,3-ДЕГИДРОАДАМАНТАНА С ДИМЕТИЛТРИСУЛЬФИДОМ

В статье рассмотрены реакции 1,3-дегидроадамантана, относящегося к напряженным мостиковым [3.3.1]пропелланам, с диметилтрисульфидом. Установлено, что при взаимодействии образуются 1,3-бис(метилтио)адамантан, 1-(метилдитио)-3-(метилтио)адамантан и 1,3-бис(метилдитио)адамантан в соотношении 1:4,5:1. Структуры полученных соединений подтверждены методами хромато-масс-спектометрии и Я М Р1 Н-спектроскопии. Выход целевого 1-(метилдитио)-3-(метилтио)адамантана составляет 50 %. Было предположено, что реакция протекает по радикальному механизму. Приведено описание эксперимента. ...

20 08 2020 22:46:24

ВЛИЯНИЕ ГИДРОЭЛЕКТРОСТАНЦИЙ НА ОКРУЖАЮЩУЮ СРЕДУ

Статья в формате PDF 267 KB...

19 08 2020 13:18:59

ВТОРИЧНЫЕ ПЕЧЕНОЧНЫЕ ПОРФИРИИ У БОЛЬНЫХ С НАСЛЕДСТВЕННЫМ HLA-АССОЦИИРОВАННЫМ ГЕМОХРОМАТОЗОМ

Проведено исследование ведущих показателей метаболизма порфиринов и железа в сопоставлении с функциональным состоянием печени у 100 больных с гемохроматозом ( Г Х), в динамике. Дана объективная оценка их роли в своевременной и правильной постановке вторичной печеночной порфирии на ранних этапах развития патологического процесса. Порфириновый обмен при наследственном гемохроматозе ( Н Г Х) характеризуется глубоко нарушенными и нестабильными показателями, затрагивающими все этапы синтеза гема гемоглобина (Hb). У больных с Н Г Х и с сопутствующими поздней кожной порфирией ( П К П) и инфекционными вирусными гепатитами В и С, независимо от типа мутации гена HFE ( С289Y или H63D) изменения в обмене железа коррелируют с нарушенным синтезом аминолевулиновой кислоты ( А Л К) и порфобилиногена ( П Б Г). У больных диагностическую ценность в определении функционального состояния печени наряду с трансаминазами представляет исследование экскреции копропорфирина ( К П) с мочой. Выявленные изменения в порфириновом обмене при гомозиготной форме Н Г Х носят постоянный, часто необратимый характер, ухудшая прогноз заболевания. ...

18 08 2020 0:19:48

ИСТОРИЯ РАЗВИТИЯ ИСТИННЫХ УЧИТЕЛЕЙ

Статья в формате PDF 104 KB...

16 08 2020 17:38:42

ОСНОВНЫЕ ПРИНЦИПЫ ДИАГНОСТИКИ РАБОТОСПОСОБНОСТИ БОРТОВОЙ АППАРАТУРЫ АВТОМАТИЧЕСКИХ КА И ВЫРАБОТКИ РЕКОМЕНДАЦИЙ ПО УСТРАНЕНИЮ НЕШТАТНЫХ СИТУАЦИЙ

При управлении автоматическими космическими аппаратами ( К А) важной проблемой является обеспечение надежного и оперативного анализа и диагностирования работоспособности бортовых систем. Это позволит своевременно выявить негативные тенденции в работе бортовой аппаратуры и предотвратить их развитие. Наибольшую актуальность проблема приобретает при управлении К А со сложными бортовыми системами, характеризующимися большим объемом телеметрических параметров, а так же при необходимости выдачи командных воздействий непосредственно в сеансах связи. Существующий опыт управления К А показывает, что в ряде случаев только своевременная выдача команд немедленного исполнения позволила обеспечить выполнение программы полета К А [1]. В настоящей работе предлагается общий подход к решению указанной проблемы, основанный на создании адекватных моделей анализа и диагностики функционирования бортовых систем и алгоритмов автоматизированной выработки рекомендаций по воздействию на К А. Ожидается, что использование в практике управления таких моделей и алгоритмов даст возможность существенно повысить эффективность работы аппаратуры, в том числе за счет оперативного устранения возникающих на борту нештатных ситуаций. ...

11 08 2020 5:11:40

МАКРО-РЕЧЕВЫЕ АКТЫ КОРПОРАТИВНОГО ДИСКУРСА

Статья в формате PDF 224 KB...

10 08 2020 1:37:50

ЗНАЧЕНИЕ СЪЕЗДОВ ЗЕМСКИХ ВРАЧЕЙ РЯЗАНСКОЙ ГУБЕРНИИ В РАЗВИТИИ ПРОФИЛАКТИЧЕСКОГО НАПРАВЛЕНИЯ МЕДИЦИНЫ КРАЯ

В статье представлены материалы о значении съездов земских врачей Рязанской губернии (1874 – 1900) и их роль в развитии профилактического направления медицины края. ...

29 07 2020 14:23:25

КЛИМАТ И РЕКРЕАЦИЯ

Статья в формате PDF 253 KB...

28 07 2020 1:33:26

ЭТИКА НОВОГО ТЫСЯЧЕЛЕТИЯ

Статья в формате PDF 211 KB...

27 07 2020 13:58:41

МЕТОДЫ УПРОЧНЕНИЯ ИОННО-ПЛАЗМЕННОЙ ОБРАБОТКОЙ

Статья в формате PDF 259 KB...

12 07 2020 17:59:12

Изомерия и гомеостаз популяций

Статья в формате PDF 102 KB...

11 07 2020 4:35:18

ДИАЛОГ КУЛЬТУР В XXI ВЕКЕ

Статья в формате PDF 281 KB...

01 07 2020 5:12:50

ЭКОЛОГИЧЕСКАЯ ОБСТАНОВКА ГОРОДА НОВОРОССИЙСКА

Статья в формате PDF 94 KB...

21 06 2020 11:21:55

К ВОПРОСУ О ДОСТУПНОСТИ ЖИЛЬЯ В ГОРОДЕ ВЛАДИВОСТОКЕ

Статья в формате PDF 100 KB...

20 06 2020 5:38:25

ДНИ КВАНТОВОЙ МЕДИЦИНЫ В ЕВРОПЕ

Статья в формате PDF 140 KB...

11 06 2020 18:54:16

КРИТЕРИИ ОТВЕТСТВЕННОГО ОТЦОВСТВА

Статья в формате PDF 116 KB...

08 06 2020 7:29:36

О природе времени

Понятие время является важнейшим понятием, как физики, так и философии. Актуальность этой проблемы обусловлена тем, что до сих пор, несмотря на широкий круг исследований, не сложилось твердо закрепленного представления о времени. В статье делается попытка раскрыть сущность понятия времени и связать меру времени с движением. За меру времени механического движения предлагается выбрать путь, пройденный, например, концом стрелки часов, участвующей не только в собственном движении относительно циферблата, как это принято, но и в сложном движении, включающем движение часов как целое относительно внешнего наблюдателя. Синхронизация хода часов производится по периодам их движений в соответствие с принятым эталоном времени. Рассматривается случай, когда часы движутся относительно внешнего наблюдателя с постоянной скоростью. Такой подход к проблеме времени позволяет понять его непрерывность и бесконечность. ...

03 06 2020 20:28:46

СУБТРОПИЧЕСКИЕ РАСТЕНИЯ ФЛОРЫ КАВКАЗА

Статья в формате PDF 121 KB...

01 06 2020 9:39:26

Туманова Анна Леоновна

Статья в формате PDF 78 KB...

31 05 2020 14:35:20

Еще:
Обзоры -1 :: Обзоры -2 :: Обзоры -3 :: Обзоры -4 :: Обзоры -5 :: Обзоры -6 :: Обзоры -7 :: Обзоры -8 :: Обзоры -9 :: Обзоры -10 :: Обзоры -11 ::

Последовательность подготовки научной работы может быть такой:

Выбор темы. Это важный этап. Во-первых, тема должна быть интересна не только вам, но и большинству слушателей, которым вы будете её докладывать, чтобы вы видели заинтересованность в их глазах, а не откровенную скуку.

Выбор целей и задач своей научной работы. То есть, нужно сузить тему. Например, тема: «Грудное вскармливание», сужение темы: «Грудное вскармливание среди студенток нашего ВУЗа». И если общая тема мало кому интересна, то суженная до рамок собственного института или университета, она становится интересной практически для всех слушателей. Целью может стать: «Содействие оптимальным условиям вскармливания грудью детей студентов нашего ВУЗа», а задачей — доказать, что специальные условия, созданные для кормящих студенток, не помешают их успеваемости, но уменьшат количество пропусков, академических отпусков и способствуют выращиванию здоровых детей — нашего будущего. Понятно, что эта тема подходит для студентов медицинских и педагогических ВУЗов, но и в других учебных учреждениях можно найти темы, интересные всем.

Разработать методы исследования и сбора информации. В случае с естественным вскармливанием, скорее всего, это будет анкетирование студенток, имеющих детей.

Систематизировать материал и подготовить презентацию.

Подготовиться к выступлению.

Выступить и получить: награду, удовольствие и опыт, чтобы в следующем году выступить ещё лучше и сорвать шквал аплодисментов, стать узнаваемым, а значит — более конкурентоспособным!