IT-Reviews    

ВЗАИМОДЕЙСТВИЕ АНАЛОГА ПЕПТИДА СЛИЯНИЯ ИЗ ГЕМАГГЛЮТИНИНА ВИРУСА ГРИППА С ФОСФОЛИПИДНЫМИ ЛИПОСОМАМИ: ИЗУЧЕНИЕ МЕТОДОМ 31Р-ЯМР

c78089d0
Лесовой Д.М. Жмак М.Н. Люкманова Е.Н. Дубовский П.В. Статья в формате PDF 112 KB

Пептиды слияния - фрагменты вирусных белков, состоящие из 20-25 аминокислот, способные вызывать слияние липидных и биологических мембран [1]. При изучении этих процессов удобно работать с водорастворимыми аналогами. Нами сконструирован аналог F31, состоящий из 31-го аминокислотного остатка: glfgaiagfieggwtgmidgwygygggkkkk.

С-концевой фрагмент GCGKKK обеспечивает водорастворимостиь пептида, а N-концевая часть (остатки 1-24) соответствует пептиду слияния из гемагглютинина (штамм A/PR/8/34). В пептиде имеется только один остаток глутаминовой кислоты (Glu11). Цель данной работы - изучить влияние пептида F31 на фосфолипидные липосомы при различных состояниях ионизации этого остатка. С учётом данных по величинам рКа остатков Glu в пептидах слияния, находящихся в мембранном окружении, есть основания считать, что при изменении рН от 7 до 4 с большой долей вероятности происходит протонирование боковой карбоксильной группы этого остатка. Поэтому нами взяты эти значения рН как такие, при которых остаток полностью заряжен (рН 7) и нейтрален (рН 4), соответственно. Фосфолипидные липосомы формировались из анионного фосфолипида диолеоилфосфатидилглицерина (ДОФГ). Т.к. заряд пептида в целом положителен при обоих значениях рН (4 и 7), это обеспечивает эффективное связывание с пловерхностью липосом за счёт электростатического притяжения. Следовательно, изменение характера вляиния пептида на липосомы при изменении рн от 7 до 4 будет означать изменение характера гидрофобного взаимодействия пептида с липосомами, вероятно, за счёт изменения глубины проникновения пептида в фосфолипидный бислой и/или характера ассоции пептидов на липосомах.

Наиболее удобным методом для исследования взаимодействий липид/пептид является метод 31P-ЯМР спектроскопии широких линий. Данный метод позволяет работать с бислойными мультиламеллярными липосомами, которые более адекватно моделирует биологическую мембрану. Показано, что форма линии 31P-ЯМР спектров мембран чувствительна к анизотропным движениям молекул фосфолипидов[2, 3], что позволяет следить за изменениями состояния модельной мембраны под воздействием пептида.

Для изучения рН-зависимости взаимодействия были проведены серии экспериментов при рН 4 и 7. Проанализировав полученные 31Р-ЯМР спектры с помощью разработанной нами программы P-FIT [4], были получены зависимости параметров, характеризующих состояние бислоя в зависимости от соотношения липид/пептид.

При рН 4 наблюдается значительное влияние пептида на состояние бислоя. Так, при последовательном добавлении пептида, начиная с соотношения липид/пептид 40:1 происходит формирование второй анизотропной составляющей. Данная составляющая характеризуется уменьшенным значением анизотропии химического сдвига а также уменьшенным значением степени деформации липосом магнитным полем спектрометра, что связано с уменьшением эластичности мембраны. При уменьшением соотношения липид/пептид от 40:1 до 15:1 происходит рост вклада этой составляющей от ~15% до ~50%. Также стоит отметить что начиная с соотношения липид/пептид 30:1 становится значительным вклад от изотропной составляющей, которая соответствует разрушенным липосомам. Величина этой составляющей растёт пропорционально количеству добавленного пептида и достигает значений 3-4%.

При рН 7 картина взаимодействия существенно иная: Во всём изученном диапазоне значений липид/пептид(от 50 до 15) не наблюдалось формирование дополнительных состояний модельного липидного бислоя. В то время как наблюдалось небольшое изменение параметров эластичности бислоя.

Таким образом, анализ влияния пептида на бислои ДОФГ при выбранных значениях рН подтверждает предположение о существенной роли ионогенного сотояния состояния остатка Glu11 во взаимодействии пептида слияния этого типа с липидным бислоем.

Благодарность:

Выражаем признательность РФФИ за финансовую поддержку, грант № 02-48882.

СПИСОК ЛИТЕРАТУРЫ

  1. Dubovskii, P.V., Li, H., Takahashi, S., Arseniev, A.S., and Akasaka, K.Protein Sci., 2000 V. 9, P. 786-798.
  2. Seelig J. Biochim. Biophys. Acta. 1978. V. 515. P. 105-140.
  3. Brumm T., Mops A., Dolainsky C., Bruckner S., Bayerl T.M. Biophys. J. 1992. V. 61. P. 1018-1024.
  4. Dubovskii P.V., Lesovoy D.M., Dubinnyi M.A., Utkin Y.N., Arseniev A.S. // Eur. J. Biochem. 2003. V. 270. P. 2038-2046.



Отзывы (через Facebook):

Оставить отзыв с помощью аккаунта FaceBook:

КАЗАНСКИЙ КРАЙ: ЯЗЫК ПАМЯТНИКОВ XVI-XVII ВЕКОВ

Статья в формате PDF 282 KB...

21 07 2020 2:12:35

МИКОПЕЙЗАЖ КОЖИ РАБОЧИХ МУКОМОЛЬНОГО ПРОИЗВОДСТВА

Статья в формате PDF 108 KB...

20 07 2020 3:19:11

НООСФЕРНОЕ ОБРАЗОВАНИЕ – ОТ ПРОШЛОГО К БУДУЩЕМУ

Статья в формате PDF 119 KB...

18 07 2020 18:27:57

НОВОЕ УСТРОЙСТВО ДЛЯ УДАЛЕНИЯ ЗУБНЫХ ОТЛОЖЕНИЙ

Статья в формате PDF 112 KB...

16 07 2020 23:42:48

Перспективы использования электрофизических методов при освоении месторождений минерального сырья

На основе анализа литературных источников показана необходимость создания эффективных методов переработки руд цветных металлов. Описано отрицательное воздействие горнообогатительного производства на окружающую среду. Рассмотрены проблемы освоения месторождений сырья и предложены пути их решения. Приведена схема рационального освоения минеральных ресурсов рудного месторождения с применением разрядноимпульсных методов. Обоснована возможность использования разрядноимпульсных воздействий в обогатительных процессах, что позволит повысить полноту извлечения полезных компонентов при переработке минерального сырья. Выделены ограничения применения импульсных методов. Установлено, что разрядноимпульсные методы интенсифицируют избирательное раскрытие минеральных ассоциаций во всем диапазоне исходных классов крупности. Эти методы эффективны в комбинированных схемах переработки труднообогатимых руд сложного состава. Применение комбинированных схем позволит сократить на 10–15 % время измельчения до выхода контрольного класса. ...

15 07 2020 19:49:20

О ПРОБЛЕМЕ ПОДРОСТКОВОЙ НАРКОМАНИИ В РОССИИ

Применение большого спектра фармакологических препаратов, как природного происхождения, так и синтезированных требует создания стабильных условий, которые необходимы лечащему врачу при проведении все более усложняющихся ступеней вмешательства человека взаимодействие среды и живого организма. Неизбежным следствием применения лекарственных препаратов без учета механизма действия на структурно-функциональные свойства мембранных взаимодействий, является развитие побочных реакций, отличающихся по своей природе, тяжести клинических проявлений и скорости нарастания. ...

14 07 2020 8:46:43

СУБЪЕКТИВНЫЕ БАРЬЕРЫ ОБЩЕНИЯ У ПОДРОСТКОВ

Статья в формате PDF 114 KB...

05 07 2020 23:13:28

ПАРАЛЛЕЛЬНЫЙ АЛГОРИТМ (2,1)-МЕТОДА ПЕРЕМЕННОГО ШАГА

Статья в формате PDF 505 KB...

04 07 2020 5:42:28

ПРОБЛЕМЫ ЕСТЕСТВЕННОНАУЧНОГО ОБРАЗОВАНИЯ

Статья в формате PDF 225 KB...

03 07 2020 2:58:18

КЛИМАТ И РЕКРЕАЦИЯ

Статья в формате PDF 253 KB...

02 07 2020 2:41:10

ЭПИДЕМИЧЕСКАЯ БЕЗОПАСНОСТЬ ТУРИСТА

Статья в формате PDF 116 KB...

29 06 2020 12:38:28

БИОДИНАМИКА ПРЫЖКОВ В ВЫСОТУ

Статья в формате PDF 657 KB...

28 06 2020 13:41:37

ВЛИЯНИЕ СОЧЕТАНИЯ ФИТОГОРМОНОВ И ВИТАМИНОВ НА РОСТ И ПРОДУКТИВНОСТЬ ХЛОПЧАТНИКА В УСЛОВИЯХ ВОЛГО-АХТУБИНСКОЙ ПОЙМЫ АСТРАХАНСКОЙ ОБЛАСТИ

Установлено, что предпосевное замачивание семян и опрыскивание вегетирующих растений хлопчатника (Gossipium hirsutum L.) растворами сочетаний фитогормонов кинетина ( К Н) и гибберелловой кислоты ( Г К) и совместно с витаминами никотиновой кислотой ( Н К) и пантотеновой кислотой ( П К) эффективно стимулирует полевую всхожесть семян, рост стебля и образование побегов, среднюю площадь листа и общую фотосинтетическую листовую поверхность, улучшение водного режима. Также отмечено увеличение числа коробочек, длины волокна и выхода волокна с растения от 34,6 до 60,4 %. Наиболее эффективно предпосевное замачивание семян сочетанием фитогормонов совместно с витаминами. ...

26 06 2020 0:50:57

ПЕРСОНАЛ БАНКА КАК ВАЖНЕЙШИЙ ЕГО КАПИТАЛ

Статья в формате PDF 118 KB...

25 06 2020 1:59:30

ОЦЕНКА СИНТЕЗИРОВАННЫХ СОРБЕНТОВ

Статья в формате PDF 208 KB...

19 06 2020 17:48:38

АНДРЕЕВА МАРИЯ АНДРЕЕВНА

Статья в формате PDF 84 KB...

11 06 2020 3:18:32

ИСПОЛЬЗОВАНИЕ МЕТОДА ПРОЕКТОВ В ЛИЦЕЕ ПРИ ВУЗЕ

Статья в формате PDF 97 KB...

30 05 2020 23:32:33

О ВЛИЯНИИ ГЕОМАГНИТНОГО ПОЛЯ (ГМП) НА БИОТУ

Статья в формате PDF 85 KB...

25 05 2020 14:16:31

ВЛИЯНИЕ ТЕРАПИИ БИЛЬТРИЦИДОМ И УРСОСАНОМ НА ЖЕЛЧНЫЙ ЛИТОГЕНЕЗ В РЕЗИДУАЛЬНУЮ ФАЗУ ОПИСТОРХОЗА

Обследовано 19 здоровых людей и 33 пациента с описторхозом и холелитиазом. Проведена сравнительная оценка некоторых показателей холестеринового, пигментного, белкового обмена в пузырной и печеночной порции желчи у обследованных пациентов до и после терапии бильтрицидом и урсосаном. Выявлено, что у пациентов с описторхозом и холелитиазом в эффективные сроки после монотерапии бильтрицидом отмечается значимое превышение концентрации непрямого билирубина, холестерина и белка в пузырной желчи по сравнению со здоровыми людьми, что свидетельствует о сохранении остаточных явлений при значительном улучшении пигментного обмена и снижении литогенных свойств желчи. Включение в схему подготовки и проведения антигельминтной терапии урсосана позволяет достигнуть наибольшего гиполитогенного состояния пузырной порции желчи в эффективные сроки после терапии бильтрицидом. ...

04 05 2020 15:24:50

ИННОВАЦИОННЫЕ ВУЗЫ В УСЛОВИЯХ РЫНОЧНОЙ ЭКОНОМИКИ

Статья в формате PDF 115 KB...

26 04 2020 12:47:45

БОЛЕЗНИ ПЕРВИЧНОГО ИММУНОДЕФИЦИТА У ВЗРОСЛЫХ

Статья в формате PDF 98 KB...

22 04 2020 17:30:42

ТЕПЛОВОЙ РАЗГОН В ЩЕЛОЧНЫХ АККУМУЛЯТОРАХ

Статья в формате PDF 121 KB...

21 04 2020 14:13:29

ЛЖЕУЧЕНИЯ И ПАРАНАУКА ХХ ВЕКА Часть 1

Проведен анализ общепринятых учений и научных теорий, имевших широкую аудиторию в вузах и научно-исследовательских институтах прошлого века. Выявлена недостаточность абстрактной потенции в мыслительной жизни homo sensus, главная альтернатива которой – эмоциональный мир, чувственность и вера. Свойство верить познающего субъекта не носит характер религиозности, однако имеет общие с ней основания. Роднит религию и научную веру стремление не понять, а принять смутные представления, сулящие сиюминутную пользу и выгоду, объединяет желание увидеть в таинственном и запредельном нечто к себе доброжелательное, освобождающее от мучительного предназначения думать и, следовательно, уводящее от необходимости работать – работать без самообмана, но эффективно и достойно homo sapiens. ...

10 04 2020 17:32:18

PROBLEMS OF BIOCHEMICAL INDICATION OF STATUS OF FISHES OF NORTH BASIN

Статья в формате PDF 127 KB...

09 04 2020 20:22:27

Алгоритм проведения дифференциальной диагностики

Статья в формате PDF 104 KB...

08 04 2020 2:44:45

ЗАКОН ВЕКОВОГО СМЕЩЕНИЯ ПЛАНЕТ

Статья в формате PDF 127 KB...

06 04 2020 22:42:32

ЩИТОВИДНАЯ ЖЕЛЕЗА: ПОКАЗАТЕЛЬ ПЛОЩАДИ КОНТАКТА ЭПИТЕЛИЙ-СТРОМА

Разработан новый морфометрический показатель площади контакта эпителия и стромы. Показатель использовался автором при многолетних исследованиях морфофункционального состояния щитовидной железы у женщин и в эксперименте. ...

04 04 2020 14:55:54

ОСНОВЫ МЕНЕДЖМЕНТА

Статья в формате PDF 279 KB...

03 04 2020 3:56:43

БИОЛОГИЯ И ПРОБЛЕМЫ ОХРАНЫ СУРКОВ В КУЗБАССЕ

Статья в формате PDF 112 KB...

29 03 2020 6:26:32

ГЕОЭКОЛОГИЧЕСКИЕ ПРОБЛЕМЫ СОВРЕМЕННОЙ РАКЕТНО-КОСМИЧЕСКОЙ ДЕЯТЕЛЬНОСТИ

К настоящему времени геофизика накопила о магнетизме Земли огромную информацию, большая часть которой получена в новейший период исследований космического пространства путём непосредственных инструментальных исследований с помощью космических летательных аппаратов, но построить на традиционных теоретических основаниях общепризнанную теорию о происхождении магнетизма Земли пока не удавалось никому [1]. Учитывая продуктивность магнитодинамического взгляда ряда фундаментальных проблем физики и многочисленных технических задач [2], можно надеяться на аналогичную продуктивность при рассмотрении некоторых из многочисленных аспектов фундаментальной проблемы стационарного геомагнетизма, среди которых первичной представляется его происхождение. ...

24 03 2020 5:31:57

ВЛИЯНИЕ ГИДРОЭЛЕКТРОСТАНЦИЙ НА ОКРУЖАЮЩУЮ СРЕДУ

Статья в формате PDF 267 KB...

23 03 2020 1:58:53

ЖИЗНЬ ЭТО...

« Что такое жизнь?» Этот вопрос занимает человечество с древнейших времён. Многие философы и естествоиспытатели пытались и пытаются разрешить этот вопрос, определить жизнь как явление. Существует множество определений жизни, но, несмотря на это, среди них нет ни одного, который бы наиболее полно отразил основной принцип существования жизни, её сущность. В предлагаемой вашему вниманию статье сделана ещё одна попытка объяснения феномена жизни. Её основная идея: Жизнь - это самовоспроизводящийся катализатор диссипации энергии. Что касается самовоспроизведения, то здесь всё более или менее понятно, а вот словосочетание «катализатор диссипации» требует некоторых разъяснений. Диссипация - термин, обозначающий рассеяние энергии, т.е. её переход с потенциально более высокого уровня на более низкий - тепловой уровень. В свете рассматриваемого определения жизни подразумевается, что энергия квантов солнечного света, которые могут странствовать в космосе «бесконечно», будучи поглощенной растениями поэтапно диссипатируется, в процессах жизнедеятельности и формирования собственных структур последовательными участниками пищевой цепи (растение - травоядное - хищник - падальщики), в тепловое излучение. Таким образом, живое вещество, многократно ускоряя процесс диссипации энергии солнечных квантов в тепловое излучение, играет в нем роль специфического катализатора. Далее рассматривается ряд важных следствий, вытекающих из данного определения. ...

21 03 2020 11:28:38

ПЕРСИСТЕНТНЫЕ СВОЙСТВА МИКРОФЛОРЫ КОЖИ И КИШЕЧНИКА

Статья в формате PDF 111 KB...

18 03 2020 16:14:58

ОЦЕНКА ТЕПЛОВОГО СОСТОЯНИЯ НАРУШЕННЫХ ЛАНДШАФТОВ ПРИ ВОССТАНОВЛЕНИИ РАСТИТЕЛЬНОСТИ

Проанализированы изменения теплового состояния грунтов при техногенных воздействиях. Выявлено значительное повышение среднегодовой температуры верхних горизонтов криолитозоны и увеличение глубины сезонного протаивания при вырубке леса и удалении напочвенного покрова, вырубке леса на гарях в межаласном типе местности. Количественно оценена динамика среднегодовой температуры грунтов на разнорежимных вырубках, на гарях в зависимости от стадий сукцессионного развития растительности. ...

15 03 2020 6:50:47

Стратегический ресурс России – новые знания (паспорт научной специальности – вербальная модель диссертационной работы)

В статье раскрываются новые знания, которые становятся стратегическим ресурсом, обеспечивают России статус великой державы и формирование упреждающей реакции на скрытые угрозы национальным интересам. Паспорта научных специальностей способствуют консолидации интеллектуальных ресурсов страны на самых актуальных направлениях исследований. Выявленные различия характеризуют определяющую роль паспорта научной специальности в резонансном взаимодействии с диссертационными работами, при наличии которого достигается соответствие предмета исследования паспорту научной специальности. Резонансное взаимодействие объекта и субъекта в научном творчестве при выполнении диссертационной работы составляет основной принцип интеллектуальной информационной технологии как инструмента научного творчества. ...

14 03 2020 12:41:47

Успехи и перспективы развития эмбриологии

Статья в формате PDF 104 KB...

13 03 2020 8:14:14

УСТАНОВЛЕНИЕ ОПТИМАЛЬНОГО ПЕРИОДА ПРОГНОЗИРОВАНИЯ

Статья в формате PDF 264 KB...

12 03 2020 14:42:11

Еще:
Обзоры -1 :: Обзоры -2 :: Обзоры -3 :: Обзоры -4 :: Обзоры -5 :: Обзоры -6 :: Обзоры -7 :: Обзоры -8 :: Обзоры -9 :: Обзоры -10 :: Обзоры -11 ::

Последовательность подготовки научной работы может быть такой:

Выбор темы. Это важный этап. Во-первых, тема должна быть интересна не только вам, но и большинству слушателей, которым вы будете её докладывать, чтобы вы видели заинтересованность в их глазах, а не откровенную скуку.

Выбор целей и задач своей научной работы. То есть, нужно сузить тему. Например, тема: «Грудное вскармливание», сужение темы: «Грудное вскармливание среди студенток нашего ВУЗа». И если общая тема мало кому интересна, то суженная до рамок собственного института или университета, она становится интересной практически для всех слушателей. Целью может стать: «Содействие оптимальным условиям вскармливания грудью детей студентов нашего ВУЗа», а задачей — доказать, что специальные условия, созданные для кормящих студенток, не помешают их успеваемости, но уменьшат количество пропусков, академических отпусков и способствуют выращиванию здоровых детей — нашего будущего. Понятно, что эта тема подходит для студентов медицинских и педагогических ВУЗов, но и в других учебных учреждениях можно найти темы, интересные всем.

Разработать методы исследования и сбора информации. В случае с естественным вскармливанием, скорее всего, это будет анкетирование студенток, имеющих детей.

Систематизировать материал и подготовить презентацию.

Подготовиться к выступлению.

Выступить и получить: награду, удовольствие и опыт, чтобы в следующем году выступить ещё лучше и сорвать шквал аплодисментов, стать узнаваемым, а значит — более конкурентоспособным!